LOCUS BC100882 705 bp mRNA linear HUM 17-JUL-2007 DEFINITION Homo sapiens lysozyme G-like 2, mRNA (cDNA clone MGC:119046 IMAGE:40003264), complete cds. ACCESSION BC100882 VERSION BC100882.3 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 705) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 705) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2005) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT On Oct 4, 2006 this sequence version replaced BC100882.2. Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 6 Row: c Column: 23. FEATURES Location/Qualifiers source 1..705 /db_xref="H-InvDB:HIT000336303" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:119046 IMAGE:40003264" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_283" /note="Vector: pCR-Blunt II-TOPO with reversed insert; Clone identification sequence tag: ATCTC sequenced from the forward primer" gene 1..705 /gene="LYG2" /gene_synonym="LYGH" /db_xref="GeneID:254773" /db_xref="HGNC:HGNC:29615" CDS 22..660 /gene="LYG2" /gene_synonym="LYGH" /codon_start=1 /product="lysozyme G-like 2" /protein_id="AAI00883.1" /db_xref="GeneID:254773" /db_xref="HGNC:HGNC:29615" /translation="MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIM TMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAII SRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQ KKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF" BASE COUNT 184 a 174 c 181 g 166 t ORIGIN 1 tggaagataa gattccccgc catgttatcc tccgtggtgt tttggggact aattgccctc 61 attggcactt ccaggggctc ataccccttc agtcactcaa tgaagcctca cctacatcca 121 cgcctgtacc acggctgcta tggggacatc atgaccatga agacctctgg ggccacttgt 181 gatgcaaaca gtgtgatgaa ctgcgggatc cgtggttctg aaatgtttgc tgagatggat 241 ttgagggcca taaaacctta ccagactctg atcaaagaag tcgggcagag acattgcgtg 301 gaccctgctg tcatcgcagc catcatctcc agggaaagcc atggcggatc tgtcctgcaa 361 gacggctggg accacagggg acttaaattt ggcttgatgc agcttgataa acaaacgtac 421 caccctgtcg gtgcctggga tagcaaagag cacctttcac aggctactgg gattctaaca 481 gagagaatta aggcaatcca gaaaaaattc cccacgtgga gtgttgctca gcacctcaaa 541 ggtggtctct cagcttttaa gtcaggaatt gaagcgattg ccaccccatc ggacatagac 601 aatgacttcg tcaatgatat cattgctcga gctaagttct ataaaagaca aagcttctag 661 gcaaagctct gtgggtgggc caggttggca gagtgctcag atggc //