LOCUS       BC100882                 705 bp    mRNA    linear   HUM 17-JUL-2007
DEFINITION  Homo sapiens lysozyme G-like 2, mRNA (cDNA clone MGC:119046
            IMAGE:40003264), complete cds.
ACCESSION   BC100882
VERSION     BC100882.3
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 705)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 705)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2005) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Oct 4, 2006 this sequence version replaced BC100882.2.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 6 Row: c Column: 23.
FEATURES             Location/Qualifiers
     source          1..705
                     /db_xref="H-InvDB:HIT000336303"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:119046 IMAGE:40003264"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_283"
                     /note="Vector: pCR-Blunt II-TOPO with reversed insert;
                     Clone identification sequence tag: ATCTC sequenced from
                     the forward primer"
     gene            1..705
                     /gene="LYG2"
                     /gene_synonym="LYGH"
                     /db_xref="GeneID:254773"
                     /db_xref="HGNC:HGNC:29615"
     CDS             22..660
                     /gene="LYG2"
                     /gene_synonym="LYGH"
                     /codon_start=1
                     /product="lysozyme G-like 2"
                     /protein_id="AAI00883.1"
                     /db_xref="GeneID:254773"
                     /db_xref="HGNC:HGNC:29615"
                     /translation="MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIM
                     TMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAII
                     SRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQ
                     KKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF"
BASE COUNT          184 a          174 c          181 g          166 t
ORIGIN      
        1 tggaagataa gattccccgc catgttatcc tccgtggtgt tttggggact aattgccctc
       61 attggcactt ccaggggctc ataccccttc agtcactcaa tgaagcctca cctacatcca
      121 cgcctgtacc acggctgcta tggggacatc atgaccatga agacctctgg ggccacttgt
      181 gatgcaaaca gtgtgatgaa ctgcgggatc cgtggttctg aaatgtttgc tgagatggat
      241 ttgagggcca taaaacctta ccagactctg atcaaagaag tcgggcagag acattgcgtg
      301 gaccctgctg tcatcgcagc catcatctcc agggaaagcc atggcggatc tgtcctgcaa
      361 gacggctggg accacagggg acttaaattt ggcttgatgc agcttgataa acaaacgtac
      421 caccctgtcg gtgcctggga tagcaaagag cacctttcac aggctactgg gattctaaca
      481 gagagaatta aggcaatcca gaaaaaattc cccacgtgga gtgttgctca gcacctcaaa
      541 ggtggtctct cagcttttaa gtcaggaatt gaagcgattg ccaccccatc ggacatagac
      601 aatgacttcg tcaatgatat cattgctcga gctaagttct ataaaagaca aagcttctag
      661 gcaaagctct gtgggtgggc caggttggca gagtgctcag atggc
//