LOCUS       BC100846                 252 bp    mRNA    linear   HUM 18-MAR-2009
DEFINITION  Homo sapiens defensin, beta 106B, mRNA (cDNA clone MGC:118940
            IMAGE:40002126), complete cds.
ACCESSION   BC100846
VERSION     BC100846.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 252)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 252)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2005) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 12, 2005 this sequence version replaced BC100846.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 6 Row: d Column: 7.
FEATURES             Location/Qualifiers
     source          1..252
                     /db_xref="H-InvDB:HIT000336271_04"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:118940 IMAGE:40002126"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_283"
                     /note="Vector: pCR-Blunt II-TOPO with reversed insert;
                     Clone identification sequence tag: GTTCCTTA sequenced from
                     the forward primer"
     gene            1..252
                     /gene="DEFB106B"
                     /db_xref="GeneID:503841"
                     /db_xref="HGNC:HGNC:28879"
     CDS             6..203
                     /gene="DEFB106B"
                     /codon_start=1
                     /product="defensin, beta 106B"
                     /protein_id="AAI00847.1"
                     /db_xref="GeneID:503841"
                     /db_xref="HGNC:HGNC:28879"
                     /translation="MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELI
                     ALCQKSLKCCRTIQPCGSIID"
BASE COUNT           74 a           54 c           51 g           73 t
ORIGIN      
        1 cagtcatgag gactttcctc tttctctttg ccgtgctctt ctttctgacc ccagccaaga
       61 atgcattttt tgatgagaaa tgcaacaaac ttaaagggac atgcaagaac aattgcggga
      121 aaaatgaaga acttattgct ctctgccaga agtctctgaa atgctgtcgg accatccagc
      181 catgtgggag cattatagat taatgcagaa gatttaggtt tccagagaag catacataac
      241 ctagcttctt tt
//