LOCUS BC100845 252 bp mRNA linear HUM 18-MAR-2009 DEFINITION Homo sapiens defensin, beta 106B, mRNA (cDNA clone MGC:118939 IMAGE:40002125), complete cds. ACCESSION BC100845 VERSION BC100845.2 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 252) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 252) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2005) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT On Aug 12, 2005 this sequence version replaced BC100845.1. Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 6 Row: c Column: 8. FEATURES Location/Qualifiers source 1..252 /db_xref="H-InvDB:HIT000336270_04" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:118939 IMAGE:40002125" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_283" /note="Vector: pCR-Blunt II-TOPO with reversed insert; Clone identification sequence tag: AGATCTTCA sequenced from the forward primer" gene 1..252 /gene="DEFB106B" /db_xref="GeneID:503841" /db_xref="HGNC:HGNC:28879" CDS 6..203 /gene="DEFB106B" /codon_start=1 /product="defensin, beta 106B" /protein_id="AAI00846.1" /db_xref="GeneID:503841" /db_xref="HGNC:HGNC:28879" /translation="MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELI ALCQKSLKCCRTIQPCGSIID" BASE COUNT 74 a 54 c 51 g 73 t ORIGIN 1 cagtcatgag gactttcctc tttctctttg ccgtgctctt ctttctgacc ccagccaaga 61 atgcattttt tgatgagaaa tgcaacaaac ttaaagggac atgcaagaac aattgcggga 121 aaaatgaaga acttattgct ctctgccaga agtctctgaa atgctgtcgg accatccagc 181 catgtgggag cattatagat taatgcagaa gatttaggtt tccagagaag catacataac 241 ctagcttctt tt //