LOCUS BC096173 737 bp mRNA linear HUM 04-OCT-2006 DEFINITION Homo sapiens crystallin, beta A4, mRNA (cDNA clone MGC:116824 IMAGE:40003451), complete cds. ACCESSION BC096173 VERSION BC096173.3 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 737) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 737) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (12-MAY-2005) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT On Jun 29, 2006 this sequence version replaced BC096173.2. Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 2 Row: n Column: 7. FEATURES Location/Qualifiers source 1..737 /db_xref="H-InvDB:HIT000335461" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:116824 IMAGE:40003451" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: GGTCTACA sequenced from the reverse primer" gene 1..737 /gene="CRYBA4" /db_xref="GeneID:1413" /db_xref="HGNC:HGNC:2396" /db_xref="MIM:123631" CDS 28..618 /gene="CRYBA4" /codon_start=1 /product="crystallin, beta A4" /protein_id="AAH96173.1" /db_xref="GeneID:1413" /db_xref="HGNC:HGNC:2396" /db_xref="MIM:123631" /translation="MTLQCTKSAGPWKMVVWDEDGFQGRRHEFTAECPSVLELGFETV RSLKVLSGAWVGFEHAGFQGQQYILERGEYPSWDAWGGNTAYPAERLTSFRPAACANH RDSRLTIFEQENFLGKKGELSDDYPSLQAMGWEGNEVGSFHVHSGAWVCSQFPGYRGF QYVLECDHHSGDYKHFREWGSHAPTFQVQSIRRIQQ" BASE COUNT 144 a 205 c 238 g 150 t ORIGIN 1 cctgggccta tctcggaagg ggccacaatg accctgcaat gcacaaagtc agcgggaccc 61 tggaagatgg tggtgtggga tgaggacggc ttccagggcc ggcggcacga gttcacggcc 121 gagtgcccca gcgtgctgga gcttggcttc gagactgtgc gatctttgaa agtgctgagt 181 ggagcgtggg tgggctttga gcatgctggc ttccaagggc agcagtacat tctggaacga 241 ggcgaatatc caagctggga tgcctggggc ggcaacacgg cctaccccgc cgagaggctc 301 acctccttcc ggcctgcggc ctgtgctaac caccgtgact cgaggctgac aatcttcgag 361 caagagaact tcctgggcaa gaaaggagag ctgagcgatg actatccttc cctccaggcc 421 atgggatggg aaggcaatga agtagggtcc ttccacgtcc actctggggc ctgggtttgc 481 tcccagtttc cgggctaccg aggatttcag tatgtgctgg aatgcgatca ccattccggt 541 gactacaaac atttccggga gtggggctct catgccccga ccttccaggt gcagagcatc 601 cgcaggatcc agcagtgaac aggggtgcgg cacggaggag cgcatgcgtg cttatctgca 661 atggaggcgc tctggaggct gtggtgtgtt ctctccttct gcctccccct gtaacctgtg 721 tgaacccagc acccatg //