LOCUS       BC096173                 737 bp    mRNA    linear   HUM 04-OCT-2006
DEFINITION  Homo sapiens crystallin, beta A4, mRNA (cDNA clone MGC:116824
            IMAGE:40003451), complete cds.
ACCESSION   BC096173
VERSION     BC096173.3
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 737)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 737)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-MAY-2005) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Jun 29, 2006 this sequence version replaced BC096173.2.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 2 Row: n Column: 7.
FEATURES             Location/Qualifiers
     source          1..737
                     /db_xref="H-InvDB:HIT000335461"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:116824 IMAGE:40003451"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: GGTCTACA sequenced from the reverse primer"
     gene            1..737
                     /gene="CRYBA4"
                     /db_xref="GeneID:1413"
                     /db_xref="HGNC:HGNC:2396"
                     /db_xref="MIM:123631"
     CDS             28..618
                     /gene="CRYBA4"
                     /codon_start=1
                     /product="crystallin, beta A4"
                     /protein_id="AAH96173.1"
                     /db_xref="GeneID:1413"
                     /db_xref="HGNC:HGNC:2396"
                     /db_xref="MIM:123631"
                     /translation="MTLQCTKSAGPWKMVVWDEDGFQGRRHEFTAECPSVLELGFETV
                     RSLKVLSGAWVGFEHAGFQGQQYILERGEYPSWDAWGGNTAYPAERLTSFRPAACANH
                     RDSRLTIFEQENFLGKKGELSDDYPSLQAMGWEGNEVGSFHVHSGAWVCSQFPGYRGF
                     QYVLECDHHSGDYKHFREWGSHAPTFQVQSIRRIQQ"
BASE COUNT          144 a          205 c          238 g          150 t
ORIGIN      
        1 cctgggccta tctcggaagg ggccacaatg accctgcaat gcacaaagtc agcgggaccc
       61 tggaagatgg tggtgtggga tgaggacggc ttccagggcc ggcggcacga gttcacggcc
      121 gagtgcccca gcgtgctgga gcttggcttc gagactgtgc gatctttgaa agtgctgagt
      181 ggagcgtggg tgggctttga gcatgctggc ttccaagggc agcagtacat tctggaacga
      241 ggcgaatatc caagctggga tgcctggggc ggcaacacgg cctaccccgc cgagaggctc
      301 acctccttcc ggcctgcggc ctgtgctaac caccgtgact cgaggctgac aatcttcgag
      361 caagagaact tcctgggcaa gaaaggagag ctgagcgatg actatccttc cctccaggcc
      421 atgggatggg aaggcaatga agtagggtcc ttccacgtcc actctggggc ctgggtttgc
      481 tcccagtttc cgggctaccg aggatttcag tatgtgctgg aatgcgatca ccattccggt
      541 gactacaaac atttccggga gtggggctct catgccccga ccttccaggt gcagagcatc
      601 cgcaggatcc agcagtgaac aggggtgcgg cacggaggag cgcatgcgtg cttatctgca
      661 atggaggcgc tctggaggct gtggtgtgtt ctctccttct gcctccccct gtaacctgtg
      721 tgaacccagc acccatg
//