LOCUS BC096114 421 bp mRNA linear HUM 04-OCT-2006 DEFINITION Homo sapiens parvalbumin, mRNA (cDNA clone MGC:116760 IMAGE:40002308), complete cds. ACCESSION BC096114 VERSION BC096114.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 421) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 421) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (12-MAY-2005) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 2 Row: d Column: 19. FEATURES Location/Qualifiers source 1..421 /db_xref="H-InvDB:HIT000335402" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:116760 IMAGE:40002308" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_283" /note="Vector: pCR-Blunt II-TOPO with reversed insert; Clone identification sequence tag: GGATCAAA sequenced from the forward primer" gene 1..421 /gene="PVALB" /gene_synonym="D22S749" /db_xref="GeneID:5816" /db_xref="HGNC:HGNC:9704" /db_xref="MIM:168890" CDS 57..389 /gene="PVALB" /gene_synonym="D22S749" /codon_start=1 /product="parvalbumin" /protein_id="AAH96114.1" /db_xref="GeneID:5816" /db_xref="HGNC:HGNC:9704" /db_xref="MIM:168890" /translation="MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDV KKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDE FSTLVAES" BASE COUNT 113 a 108 c 115 g 85 t ORIGIN 1 accagcccag cctttcagtg caggctccag ccctccaccc ccacccgagt tgcaggatgt 61 cgatgacaga cttgctgaac gctgaggaca tcaagaaggc ggtgggagcc tttagcgcta 121 ccgactcctt cgaccacaaa aagttcttcc aaatggtcgg cctgaagaaa aagagtgcgg 181 atgatgtgaa gaaggtgttt cacatgctgg acaaggacaa aagtggcttc atcgaggagg 241 atgagctggg attcatccta aaaggcttct ccccagatgc cagagacctg tctgctaaag 301 aaaccaagat gctgatggct gctggagaca aagatgggga cggcaaaatt ggggttgacg 361 aattctccac tctggtggct gaaagctaag aagcactgac tgcccctggt cttccacctc 421 t //