LOCUS       BC096112                 421 bp    mRNA    linear   HUM 04-OCT-2006
DEFINITION  Homo sapiens parvalbumin, mRNA (cDNA clone MGC:116758
            IMAGE:40002305), complete cds.
ACCESSION   BC096112
VERSION     BC096112.3
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 421)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 421)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-MAY-2005) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Jun 29, 2006 this sequence version replaced BC096112.2.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 2 Row: c Column: 19.
FEATURES             Location/Qualifiers
     source          1..421
                     /db_xref="H-InvDB:HIT000335400"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:116758 IMAGE:40002305"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: AACACAAC sequenced from the reverse primer"
     gene            1..421
                     /gene="PVALB"
                     /gene_synonym="D22S749"
                     /db_xref="GeneID:5816"
                     /db_xref="HGNC:HGNC:9704"
                     /db_xref="MIM:168890"
     CDS             57..389
                     /gene="PVALB"
                     /gene_synonym="D22S749"
                     /codon_start=1
                     /product="parvalbumin"
                     /protein_id="AAH96112.1"
                     /db_xref="GeneID:5816"
                     /db_xref="HGNC:HGNC:9704"
                     /db_xref="MIM:168890"
                     /translation="MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDV
                     KKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDE
                     FSTLVAES"
BASE COUNT          113 a          108 c          115 g           85 t
ORIGIN      
        1 accagcccag cctttcagtg caggctccag ccctccaccc ccacccgagt tgcaggatgt
       61 cgatgacaga cttgctgaac gctgaggaca tcaagaaggc ggtgggagcc tttagcgcta
      121 ccgactcctt cgaccacaaa aagttcttcc aaatggtcgg cctgaagaaa aagagtgcgg
      181 atgatgtgaa gaaggtgttt cacatgctgg acaaggacaa aagtggcttc atcgaggagg
      241 atgagctggg attcatccta aaaggcttct ccccagatgc cagagacctg tctgctaaag
      301 aaaccaagat gctgatggct gctggagaca aagatgggga cggcaaaatt ggggttgacg
      361 aattctccac tctggtggct gaaagctaag aagcactgac tgcccctggt cttccacctc
      421 t
//