LOCUS BC093096 909 bp mRNA linear HUM 20-MAY-2005 DEFINITION Homo sapiens polycystic kidney and hepatic disease 1 (autosomal recessive)-like 1, mRNA (cDNA clone IMAGE:30330124), partial cds. ACCESSION BC093096 VERSION BC093096.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 909) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 909) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (04-APR-2005) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Dr. Michael Brownstein and Dr. Miklos Palkovits cDNA Library Preparation: CLONTECH Laboratories, Inc. cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 68 Row: a Column: 18 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 31377831. FEATURES Location/Qualifiers source 1..909 /db_xref="H-InvDB:HIT000334587" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:30330124" /tissue_type="Glandular pool- thyroid, parathyroid, adrenal cortex, pineal gland, submandibular gland." /clone_lib="NIH_MGC_184" /lab_host="DH10B" /note="Vector: pDNR-LIB" gene 1..>909 /gene="PKHD1L1" /gene_synonym="DKFZp586C1021" /gene_synonym="PKHDL1" /db_xref="GeneID:93035" /db_xref="MIM:607843" CDS 76..>909 /gene="PKHD1L1" /gene_synonym="DKFZp586C1021" /gene_synonym="PKHDL1" /codon_start=1 /product="PKHD1L1 protein" /protein_id="AAH93096.1" /db_xref="GeneID:93035" /db_xref="MIM:607843" /translation="MGHLWLLGIWGLCGLLLCAADPSTDGSQIIPKVTEIIPKYGSIN GATRLTIRGEGFSQANQFNYGVDNAELGNSVQLISSFQSITCDVEKDASHSTQITCYT RAMPEDSYTVRVSVDGVPVTENNTCKGHINSWECTFNAKSFRTPTIRSITPLSGTPGT LITIQGRIFTDVYGSNIALSSNGKNVRILRVYIGGMPCELLIPQSDNLYGLKLDHPNG DMGSMVCKTTGTFIGHHNVSFILDNDYGRSFPQKMAYFVSSLNKIAMFQTKKKKKKKK KK" BASE COUNT 303 a 179 c 191 g 236 t ORIGIN 1 agtcccagga gccgagctcc agcactagag ccagctgcga gcggagggca ccaactccgc 61 agaactggct tttcaatggg acacctgtgg ctcctgggta tttggggcct ctgtgggctg 121 ctcctgtgtg ccgcggatcc cagcacagat ggctctcaaa taatccccaa agtcacagaa 181 ataataccta aatatggcag tataaatgga gcaacaaggc tgactataag aggggaaggt 241 ttttctcaag caaaccagtt taactatgga gttgataacg ctgagttggg aaacagtgtg 301 caattaattt cttctttcca gtcaattact tgtgatgtag aaaaagatgc aagtcattca 361 actcaaatta catgctatac tagagcaatg ccggaagatt cctacactgt tagagtcagt 421 gtggacgggg ttcctgttac ggaaaataac acctgcaaag gtcacatcaa cagctgggaa 481 tgtaccttca acgcaaaaag ttttagaacc ccaacaataa gaagcatcac acctttatct 541 ggaactccag gtacactaat aacaatccaa ggcagaatct tcactgatgt ctatggaagt 601 aatattgcac taagctcaaa tgggaaaaat gttaggattt tgagagttta cattggagga 661 atgccctgtg agcttctcat accacaatct gataatttat atggtctaaa actggatcat 721 ccaaatggag atatgggttc tatggtttgt aagacgactg gaacttttat tggtcatcac 781 aatgtcagct tcatcttaga taatgattat ggaaggagtt ttccacagaa aatggcatat 841 tttgtttctt ctctcaataa aattgcaatg tttcaaacca aaaaaaaaaa aaaaaaaaaa 901 aaaaaaaaa //