LOCUS       BC093096                 909 bp    mRNA    linear   HUM 20-MAY-2005
DEFINITION  Homo sapiens polycystic kidney and hepatic disease 1 (autosomal
            recessive)-like 1, mRNA (cDNA clone IMAGE:30330124), partial cds.
ACCESSION   BC093096
VERSION     BC093096.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 909)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 909)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2005) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Dr. Michael Brownstein and Dr. Miklos Palkovits
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 68 Row: a Column: 18
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 31377831.
FEATURES             Location/Qualifiers
     source          1..909
                     /db_xref="H-InvDB:HIT000334587"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:30330124"
                     /tissue_type="Glandular pool- thyroid, parathyroid,
                     adrenal cortex, pineal gland, submandibular gland."
                     /clone_lib="NIH_MGC_184"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            1..>909
                     /gene="PKHD1L1"
                     /gene_synonym="DKFZp586C1021"
                     /gene_synonym="PKHDL1"
                     /db_xref="GeneID:93035"
                     /db_xref="MIM:607843"
     CDS             76..>909
                     /gene="PKHD1L1"
                     /gene_synonym="DKFZp586C1021"
                     /gene_synonym="PKHDL1"
                     /codon_start=1
                     /product="PKHD1L1 protein"
                     /protein_id="AAH93096.1"
                     /db_xref="GeneID:93035"
                     /db_xref="MIM:607843"
                     /translation="MGHLWLLGIWGLCGLLLCAADPSTDGSQIIPKVTEIIPKYGSIN
                     GATRLTIRGEGFSQANQFNYGVDNAELGNSVQLISSFQSITCDVEKDASHSTQITCYT
                     RAMPEDSYTVRVSVDGVPVTENNTCKGHINSWECTFNAKSFRTPTIRSITPLSGTPGT
                     LITIQGRIFTDVYGSNIALSSNGKNVRILRVYIGGMPCELLIPQSDNLYGLKLDHPNG
                     DMGSMVCKTTGTFIGHHNVSFILDNDYGRSFPQKMAYFVSSLNKIAMFQTKKKKKKKK
                     KK"
BASE COUNT          303 a          179 c          191 g          236 t
ORIGIN      
        1 agtcccagga gccgagctcc agcactagag ccagctgcga gcggagggca ccaactccgc
       61 agaactggct tttcaatggg acacctgtgg ctcctgggta tttggggcct ctgtgggctg
      121 ctcctgtgtg ccgcggatcc cagcacagat ggctctcaaa taatccccaa agtcacagaa
      181 ataataccta aatatggcag tataaatgga gcaacaaggc tgactataag aggggaaggt
      241 ttttctcaag caaaccagtt taactatgga gttgataacg ctgagttggg aaacagtgtg
      301 caattaattt cttctttcca gtcaattact tgtgatgtag aaaaagatgc aagtcattca
      361 actcaaatta catgctatac tagagcaatg ccggaagatt cctacactgt tagagtcagt
      421 gtggacgggg ttcctgttac ggaaaataac acctgcaaag gtcacatcaa cagctgggaa
      481 tgtaccttca acgcaaaaag ttttagaacc ccaacaataa gaagcatcac acctttatct
      541 ggaactccag gtacactaat aacaatccaa ggcagaatct tcactgatgt ctatggaagt
      601 aatattgcac taagctcaaa tgggaaaaat gttaggattt tgagagttta cattggagga
      661 atgccctgtg agcttctcat accacaatct gataatttat atggtctaaa actggatcat
      721 ccaaatggag atatgggttc tatggtttgt aagacgactg gaacttttat tggtcatcac
      781 aatgtcagct tcatcttaga taatgattat ggaaggagtt ttccacagaa aatggcatat
      841 tttgtttctt ctctcaataa aattgcaatg tttcaaacca aaaaaaaaaa aaaaaaaaaa
      901 aaaaaaaaa
//