LOCUS BC069399 538 bp mRNA linear HUM 18-MAR-2009 DEFINITION Homo sapiens tumor protein p53 regulated apoptosis inducing protein 1, mRNA (cDNA clone MGC:96921 IMAGE:7262130), complete cds. ACCESSION BC069399 VERSION BC069399.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 538) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 538) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (29-APR-2004) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Baylor College of Medicine Human Genome Sequencing Center Center code: BCM-HGSC Web site: http://www.hgsc.bcm.tmc.edu/cdna/ Contact: amg@bcm.tmc.edu Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H., Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati, A.N., Gibbs, R.A. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRBR Plate: 1 Row: d Column: 4. FEATURES Location/Qualifiers source 1..538 /db_xref="H-InvDB:HIT000263550" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:96921 IMAGE:7262130" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_244" /note="Vector: pPCR-Script Amp SK(+)" gene 1..538 /gene="TP53AIP1" /gene_synonym="P53AIP1" /db_xref="GeneID:63970" /db_xref="HGNC:HGNC:29984" /db_xref="MIM:605426" CDS 88..414 /gene="TP53AIP1" /gene_synonym="P53AIP1" /codon_start=1 /product="tumor protein p53 regulated apoptosis inducing protein 1" /protein_id="AAH69399.1" /db_xref="GeneID:63970" /db_xref="HGNC:HGNC:29984" /db_xref="MIM:605426" /translation="MGSSSEVSFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHT PGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRA LDRAGN" BASE COUNT 119 a 155 c 158 g 106 t ORIGIN 1 ctaggaggca gtcccttagg cactggcccc aacaacaaat gaggagaagc caagttctct 61 gctttctgca gacagggcct cccctggatg ggatcttcct ctgaggtgag cttcagatct 121 gctcaagctt cctgcagtgg ggccaggagg cagggcctgg gcaggggaga ccagaacctc 181 tcggtgatgc ctccgaatgg cagggctcag acacacacac ctggctgggt aagtccctgc 241 agtgaaaacc gagacggtct tttgcctgcc acagccccgg gcagactctg ctctcaccgt 301 ggtgccgaca tcccaagttt tcagactcac caggacccag tgacagcatc tgggtcctca 361 gagctgcatg cggactgtcc ccagttcaga gcattggaca gagctgggaa ctgacagccc 421 tgatcaatag tcccaagagg aaggccagcc ctcctcctcc tcggaatcct gggtttctag 481 gaggcagaaa ggttttctga gaaacaaggc ttttggaagg aaggtggtgc ctggctgc //