LOCUS       BC069399                 538 bp    mRNA    linear   HUM 18-MAR-2009
DEFINITION  Homo sapiens tumor protein p53 regulated apoptosis inducing protein
            1, mRNA (cDNA clone MGC:96921 IMAGE:7262130), complete cds.
ACCESSION   BC069399
VERSION     BC069399.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 538)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 538)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-APR-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRBR Plate: 1 Row: d Column: 4.
FEATURES             Location/Qualifiers
     source          1..538
                     /db_xref="H-InvDB:HIT000263550"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:96921 IMAGE:7262130"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_244"
                     /note="Vector: pPCR-Script Amp SK(+)"
     gene            1..538
                     /gene="TP53AIP1"
                     /gene_synonym="P53AIP1"
                     /db_xref="GeneID:63970"
                     /db_xref="HGNC:HGNC:29984"
                     /db_xref="MIM:605426"
     CDS             88..414
                     /gene="TP53AIP1"
                     /gene_synonym="P53AIP1"
                     /codon_start=1
                     /product="tumor protein p53 regulated apoptosis inducing
                     protein 1"
                     /protein_id="AAH69399.1"
                     /db_xref="GeneID:63970"
                     /db_xref="HGNC:HGNC:29984"
                     /db_xref="MIM:605426"
                     /translation="MGSSSEVSFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHT
                     PGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRA
                     LDRAGN"
BASE COUNT          119 a          155 c          158 g          106 t
ORIGIN      
        1 ctaggaggca gtcccttagg cactggcccc aacaacaaat gaggagaagc caagttctct
       61 gctttctgca gacagggcct cccctggatg ggatcttcct ctgaggtgag cttcagatct
      121 gctcaagctt cctgcagtgg ggccaggagg cagggcctgg gcaggggaga ccagaacctc
      181 tcggtgatgc ctccgaatgg cagggctcag acacacacac ctggctgggt aagtccctgc
      241 agtgaaaacc gagacggtct tttgcctgcc acagccccgg gcagactctg ctctcaccgt
      301 ggtgccgaca tcccaagttt tcagactcac caggacccag tgacagcatc tgggtcctca
      361 gagctgcatg cggactgtcc ccagttcaga gcattggaca gagctgggaa ctgacagccc
      421 tgatcaatag tcccaagagg aaggccagcc ctcctcctcc tcggaatcct gggtttctag
      481 gaggcagaaa ggttttctga gaaacaaggc ttttggaagg aaggtggtgc ctggctgc
//