LOCUS       BC069361                 405 bp    mRNA    linear   HUM 25-JUN-2004
DEFINITION  Homo sapiens retinol binding protein 2, cellular, mRNA (cDNA clone
            MGC:97419 IMAGE:7262695), complete cds.
ACCESSION   BC069361
VERSION     BC069361.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 405)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 405)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-APR-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRBR Plate: 7 Row: c Column: 5.
FEATURES             Location/Qualifiers
     source          1..405
                     /db_xref="H-InvDB:HIT000263512"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:97419 IMAGE:7262695"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_244"
                     /note="Vector: pPCR-Script Amp SK(+)"
     gene            1..405
                     /gene="RBP2"
                     /gene_synonym="CRABP-II"
                     /gene_synonym="CRBP2"
                     /gene_synonym="CRBPII"
                     /gene_synonym="RBPC2"
                     /db_xref="GeneID:5948"
                     /db_xref="MIM:180280"
     CDS             1..405
                     /gene="RBP2"
                     /gene_synonym="CRABP-II"
                     /gene_synonym="CRBP2"
                     /gene_synonym="CRBPII"
                     /gene_synonym="RBPC2"
                     /codon_start=1
                     /product="RBP2 protein"
                     /protein_id="AAH69361.1"
                     /db_xref="GeneID:5948"
                     /db_xref="MIM:180280"
                     /translation="MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVID
                     QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEK
                     ENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK"
BASE COUNT          119 a           73 c          125 g           88 t
ORIGIN      
        1 atgacgaggg accagaatgg aacctgggag atggagagta atgaaaactt tgagggctac
       61 atgaaggccc tggatattga ttttgccacc cgcaagattg cagtacgtct cactcagacg
      121 aaggttattg atcaagatgg tgataacttc aagacaaaaa ccactagcac attccgcaac
      181 tatgatgtgg atttcactgt tggagtagag tttgacgagt acacaaagag cctggataac
      241 cggcatgtta aggcactggt cacctgggaa ggtgatgtcc ttgtgtgtgt gcaaaagggg
      301 gagaaggaga accgcggctg gaagcagtgg attgaggggg acaagctgta cctggagctg
      361 acctgtggtg accaggtgtg ccgtcaagtg ttcaaaaaga agtga
//