LOCUS       BC069328                 748 bp    mRNA    linear   HUM 19-AUG-2004
DEFINITION  Homo sapiens Bcl2 modifying factor, mRNA (cDNA clone MGC:96952
            IMAGE:7262161), complete cds.
ACCESSION   BC069328
VERSION     BC069328.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 748)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 748)
  AUTHORS   Director MGC Project.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-APR-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRBR Plate: 1 Row: f Column: 11.
FEATURES             Location/Qualifiers
     source          1..748
                     /db_xref="H-InvDB:HIT000263480"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:96952 IMAGE:7262161"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_277"
                     /note="Vector: pPCR-Script Amp SK(+) with reversed insert"
     gene            1..748
                     /gene="BMF"
                     /db_xref="GeneID:90427"
                     /db_xref="MIM:606266"
     CDS             125..679
                     /gene="BMF"
                     /codon_start=1
                     /product="BMF protein"
                     /protein_id="AAH69328.1"
                     /db_xref="GeneID:90427"
                     /db_xref="MIM:606266"
                     /translation="MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPL
                     SRLQLFPLTHCCGPGLQPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGY
                     RLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
                     WQILLFLHNLALNGEENRNGAGPR"
BASE COUNT          169 a          223 c          210 g          146 t
ORIGIN      
        1 tagctgctga ttctactcct gctattgctc acaaccctca gagtcaaact ttgtgaccgg
       61 gcctaggtca gaaaacgtga tcaagaaaaa gggtggttcc aggcgggccc agggaagagg
      121 agagatggag ccatctcagt gtgtggagga gctggaggat gatgtgttcc aaccagagga
      181 tggggagccg gtgacccaac ccgggagctt gctctctgct gacctgtttg cccagagcct
      241 actggactgc cccctcagcc gacttcagct cttccctctc acccactgct gtggccctgg
      301 ccttcaaccc accagccagg aagacaaagc tacccagact ctcagcccag cctcccccag
      361 ccaaggtgtc atgctgcctt gtggggtgac tgaggaaccc cagcgactct tttatggcaa
      421 tgctggctat cggcttcctc tccctgccag tttcccagca gtcttgccca ttggggagca
      481 gccccccgaa gggcagtggc aacatcaagc agaggtacag attgcccgaa agcttcagtg
      541 cattgcagac cagttccacc ggcttcatgt gcagcaacac cagcagaacc aaaatcgtgt
      601 gtggtggcag atcctcctct tcctgcacaa ccttgctttg aatggagaag agaacaggaa
      661 cggggcaggc cctaggtgag ggtgggctgc cctcttcaca tggggcacca ggaacaccgt
      721 ctggaacagg aaggacatcg ggcaggac
//