LOCUS BC069328 748 bp mRNA linear HUM 19-AUG-2004 DEFINITION Homo sapiens Bcl2 modifying factor, mRNA (cDNA clone MGC:96952 IMAGE:7262161), complete cds. ACCESSION BC069328 VERSION BC069328.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 748) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 748) AUTHORS Director MGC Project. TITLE Direct Submission JOURNAL Submitted (29-APR-2004) National Institutes of Health, Mammalian Gene Collection (MGC), Cancer Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Baylor College of Medicine Human Genome Sequencing Center Center code: BCM-HGSC Web site: http://www.hgsc.bcm.tmc.edu/cdna/ Contact: amg@bcm.tmc.edu Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H., Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati, A.N., Gibbs, R.A. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRBR Plate: 1 Row: f Column: 11. FEATURES Location/Qualifiers source 1..748 /db_xref="H-InvDB:HIT000263480" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:96952 IMAGE:7262161" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_277" /note="Vector: pPCR-Script Amp SK(+) with reversed insert" gene 1..748 /gene="BMF" /db_xref="GeneID:90427" /db_xref="MIM:606266" CDS 125..679 /gene="BMF" /codon_start=1 /product="BMF protein" /protein_id="AAH69328.1" /db_xref="GeneID:90427" /db_xref="MIM:606266" /translation="MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPL SRLQLFPLTHCCGPGLQPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGY RLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW WQILLFLHNLALNGEENRNGAGPR" BASE COUNT 169 a 223 c 210 g 146 t ORIGIN 1 tagctgctga ttctactcct gctattgctc acaaccctca gagtcaaact ttgtgaccgg 61 gcctaggtca gaaaacgtga tcaagaaaaa gggtggttcc aggcgggccc agggaagagg 121 agagatggag ccatctcagt gtgtggagga gctggaggat gatgtgttcc aaccagagga 181 tggggagccg gtgacccaac ccgggagctt gctctctgct gacctgtttg cccagagcct 241 actggactgc cccctcagcc gacttcagct cttccctctc acccactgct gtggccctgg 301 ccttcaaccc accagccagg aagacaaagc tacccagact ctcagcccag cctcccccag 361 ccaaggtgtc atgctgcctt gtggggtgac tgaggaaccc cagcgactct tttatggcaa 421 tgctggctat cggcttcctc tccctgccag tttcccagca gtcttgccca ttggggagca 481 gccccccgaa gggcagtggc aacatcaagc agaggtacag attgcccgaa agcttcagtg 541 cattgcagac cagttccacc ggcttcatgt gcagcaacac cagcagaacc aaaatcgtgt 601 gtggtggcag atcctcctct tcctgcacaa ccttgctttg aatggagaag agaacaggaa 661 cggggcaggc cctaggtgag ggtgggctgc cctcttcaca tggggcacca ggaacaccgt 721 ctggaacagg aaggacatcg ggcaggac //