LOCUS BC069296 405 bp mRNA linear HUM 25-JUN-2004 DEFINITION Homo sapiens retinol binding protein 2, cellular, mRNA (cDNA clone MGC:97407 IMAGE:7262683), complete cds. ACCESSION BC069296 VERSION BC069296.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 405) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 405) AUTHORS Strausberg,R. TITLE Direct Submission JOURNAL Submitted (29-APR-2004) National Institutes of Health, Mammalian Gene Collection (MGC), Cancer Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Baylor College of Medicine Human Genome Sequencing Center Center code: BCM-HGSC Web site: http://www.hgsc.bcm.tmc.edu/cdna/ Contact: amg@bcm.tmc.edu Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H., Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati, A.N., Gibbs, R.A. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRBR Plate: 7 Row: b Column: 5. FEATURES Location/Qualifiers source 1..405 /db_xref="H-InvDB:HIT000263448" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:97407 IMAGE:7262683" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_244" /note="Vector: pPCR-Script Amp SK(+)" gene 1..405 /gene="RBP2" /gene_synonym="CRABP-II" /gene_synonym="CRBP2" /gene_synonym="CRBPII" /gene_synonym="RBPC2" /db_xref="GeneID:5948" /db_xref="MIM:180280" CDS 1..405 /gene="RBP2" /gene_synonym="CRABP-II" /gene_synonym="CRBP2" /gene_synonym="CRBPII" /gene_synonym="RBPC2" /codon_start=1 /product="RBP2 protein" /protein_id="AAH69296.1" /db_xref="GeneID:5948" /db_xref="MIM:180280" /translation="MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVID QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEK ENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK" BASE COUNT 119 a 73 c 125 g 88 t ORIGIN 1 atgacgaggg accagaatgg aacctgggag atggagagta atgaaaactt tgagggctac 61 atgaaggccc tggatattga ttttgccacc cgcaagattg cagtacgtct cactcagacg 121 aaggttattg atcaagatgg tgataacttc aagacaaaaa ccactagcac attccgcaac 181 tatgatgtgg atttcactgt tggagtagag tttgacgagt acacaaagag cctggataac 241 cggcatgtta aggcactggt cacctgggaa ggtgatgtcc ttgtgtgtgt gcaaaagggg 301 gagaaggaga accgcggctg gaagcagtgg attgaggggg acaagctgta cctggagctg 361 acctgtggtg accaggtgtg ccgtcaagtg ttcaaaaaga agtga //