LOCUS       BC067513                 618 bp    mRNA    linear   HUM 30-JUN-2004
DEFINITION  Homo sapiens interleukin 23, alpha subunit p19, mRNA (cDNA clone
            MGC:79393 IMAGE:6971853), complete cds.
ACCESSION   BC067513
VERSION     BC067513.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 618)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 618)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-MAR-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Narayan Bhat
            cDNA Library Preparation: Bhat Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 172 Row: d Column: 7
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 28144902.
FEATURES             Location/Qualifiers
     source          1..618
                     /db_xref="H-InvDB:HIT000262671"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:79393 IMAGE:6971853"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_195"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-Dual"
     gene            1..618
                     /gene="IL23A"
                     /gene_synonym="IL-23"
                     /gene_synonym="IL-23A"
                     /gene_synonym="IL23P19"
                     /gene_synonym="P19"
                     /gene_synonym="SGRF"
                     /db_xref="GeneID:51561"
                     /db_xref="MIM:605580"
     CDS             34..603
                     /gene="IL23A"
                     /gene_synonym="IL-23"
                     /gene_synonym="IL-23A"
                     /gene_synonym="IL23P19"
                     /gene_synonym="P19"
                     /gene_synonym="SGRF"
                     /codon_start=1
                     /product="interleukin 23, alpha subunit p19, precursor"
                     /protein_id="AAH67513.1"
                     /db_xref="GeneID:51561"
                     /db_xref="MIM:605580"
                     /translation="MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLA
                     WSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEK
                     LLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLL
                     LRFKILRSLQAFVAVAARVFAHGAATLSP"
BASE COUNT          141 a          177 c          172 g          128 t
ORIGIN      
        1 agagccagcc agatttgaga agaaggcaaa aagatgctgg ggagcagagc tgtaatgctg
       61 ctgttgctgc tgccctggac agctcagggc agagctgtgc ctgggggcag cagccctgcc
      121 tggactcagt gccagcagct ttcacagaag ctctgcacac tggcctggag tgcacatcca
      181 ctagtgggac acatggatct aagagaagag ggagatgaag agactacaaa tgatgttccc
      241 catatccagt gtggagatgg ctgtgacccc caaggactca gggacaacag tcagttctgc
      301 ttgcaaagga tccaccaggg tctgattttt tatgagaagc tgctaggatc ggatattttc
      361 acaggggagc cttctctgct ccctgatagc cctgtgggcc agcttcatgc ctccctactg
      421 ggcctcagcc aactcctgca gcctgagggt caccactggg agactcagca gattccaagc
      481 ctcagtccca gccagccatg gcagcgtctc cttctccgct tcaaaatcct tcgcagcctc
      541 caggcctttg tggctgtagc cgcccgggtc tttgcccatg gagcagcaac cctgagtccc
      601 taaaggcagc agctcaag
//