LOCUS       BC067485                 413 bp    mRNA    linear   HUM 10-APR-2007
DEFINITION  Homo sapiens histone cluster 1, H2bm, mRNA (cDNA clone
            IMAGE:7002057), partial cds.
ACCESSION   BC067485
VERSION     BC067485.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 413)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 413)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-MAR-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Narayan Bhat
            cDNA Library Preparation: Bhat Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 172 Row: g Column: 13
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 15718721.
FEATURES             Location/Qualifiers
     source          1..413
                     /db_xref="H-InvDB:HIT000262643"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:7002057"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_195"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-Dual"
     gene            1..>413
                     /gene="HIST1H2BM"
                     /gene_synonym="dJ160A22.3"
                     /gene_synonym="H2B/e"
                     /db_xref="GeneID:8342"
                     /db_xref="HGNC:HGNC:4750"
                     /db_xref="MIM:602802"
     CDS             1..>413
                     /gene="HIST1H2BM"
                     /gene_synonym="dJ160A22.3"
                     /gene_synonym="H2B/e"
                     /codon_start=1
                     /product="HIST1H2BM protein"
                     /protein_id="AAH67485.1"
                     /db_xref="GeneID:8342"
                     /db_xref="HGNC:HGNC:4750"
                     /db_xref="MIM:602802"
                     /translation="MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYK
                     VLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLL
                     LPGELAKHAVSEGTKAVTKYTSSKCASRCSNSSAVT"
BASE COUNT          110 a          124 c          107 g           72 t
ORIGIN      
        1 atgcctgaac cagtcaaatc tgctccagtc cctaaaaaag gctccaagaa ggccattaac
       61 aaggctcaga agaaggatgg aaagaagcgc aaacgcagcc gcaaggagag ctactctgtg
      121 tatgtgtaca aggtgctgaa gcaggtccac cccgacaccg gcatctcttc caaggctatg
      181 ggaatcatga actccttcgt caacgacatc tttgagcgta tcgccggaga agcgtcacgc
      241 ctggcgcatt acaacaagcg ctcgaccatc acttcgaggg agatccagac ggccgtgcgc
      301 ctactgctac ccggggaatt ggccaagcac gccgtgtccg agggcaccaa ggccgtcacc
      361 aagtatacca gctccaagtg tgcctctcgc tgcagtaaca gttccgccgt gac
//