LOCUS BC067485 413 bp mRNA linear HUM 10-APR-2007 DEFINITION Homo sapiens histone cluster 1, H2bm, mRNA (cDNA clone IMAGE:7002057), partial cds. ACCESSION BC067485 VERSION BC067485.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 413) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 413) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (19-MAR-2004) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Narayan Bhat cDNA Library Preparation: Bhat Laboratory cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAK Plate: 172 Row: g Column: 13 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 15718721. FEATURES Location/Qualifiers source 1..413 /db_xref="H-InvDB:HIT000262643" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:7002057" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_195" /lab_host="DH10B" /note="Vector: pDNR-Dual" gene 1..>413 /gene="HIST1H2BM" /gene_synonym="dJ160A22.3" /gene_synonym="H2B/e" /db_xref="GeneID:8342" /db_xref="HGNC:HGNC:4750" /db_xref="MIM:602802" CDS 1..>413 /gene="HIST1H2BM" /gene_synonym="dJ160A22.3" /gene_synonym="H2B/e" /codon_start=1 /product="HIST1H2BM protein" /protein_id="AAH67485.1" /db_xref="GeneID:8342" /db_xref="HGNC:HGNC:4750" /db_xref="MIM:602802" /translation="MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYK VLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLL LPGELAKHAVSEGTKAVTKYTSSKCASRCSNSSAVT" BASE COUNT 110 a 124 c 107 g 72 t ORIGIN 1 atgcctgaac cagtcaaatc tgctccagtc cctaaaaaag gctccaagaa ggccattaac 61 aaggctcaga agaaggatgg aaagaagcgc aaacgcagcc gcaaggagag ctactctgtg 121 tatgtgtaca aggtgctgaa gcaggtccac cccgacaccg gcatctcttc caaggctatg 181 ggaatcatga actccttcgt caacgacatc tttgagcgta tcgccggaga agcgtcacgc 241 ctggcgcatt acaacaagcg ctcgaccatc acttcgaggg agatccagac ggccgtgcgc 301 ctactgctac ccggggaatt ggccaagcac gccgtgtccg agggcaccaa ggccgtcacc 361 aagtatacca gctccaagtg tgcctctcgc tgcagtaaca gttccgccgt gac //