LOCUS BC046155 548 bp mRNA linear HUM 15-JUL-2006 DEFINITION Homo sapiens NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase), mRNA (cDNA clone MGC:57685 IMAGE:6047460), complete cds. ACCESSION BC046155 VERSION BC046155.2 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 548) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 548) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (31-JAN-2003) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT On Sep 16, 2003 this sequence version replaced BC046155.1. Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC/DCTD/DTP cDNA Library Preparation: Life Technologies, Inc. cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAK Plate: 107 Row: l Column: 18. FEATURES Location/Qualifiers source 1..548 /db_xref="H-InvDB:HIT000053004" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:57685 IMAGE:6047460" /tissue_type="Skin, melanotic melanoma." /clone_lib="NIH_MGC_72" /lab_host="DH10B" /note="Vector: pCMV-SPORT6" gene 1..548 /gene="NDUFS6" /db_xref="GeneID:4726" /db_xref="HGNC:HGNC:7713" /db_xref="MIM:603848" CDS 6..380 /gene="NDUFS6" /codon_start=1 /product="NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase)" /protein_id="AAH46155.1" /db_xref="GeneID:4726" /db_xref="HGNC:HGNC:7713" /db_xref="MIM:603848" /translation="MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQ VYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYIN LDKETKTGTCGYCGLQFRQHHH" BASE COUNT 150 a 118 c 179 g 101 t ORIGIN 1 gcaaaatggc ggcggcgatg accttctgcc ggctgctgaa ccggtgtggc gaggcggcgc 61 ggagcctgcc cctgggcgcc aggtgtttcg gggtgcgggt ctcgccgacc ggggagaagg 121 tcacgcacac tggccaggtt tatgatgata aagactacag gagaattcgg tttgtaggtc 181 gtcagaaaga ggtgaatgaa aactttgcca ttgatttgat agcagagcag cccgtgagcg 241 aggtggagac tcgggtgata gcgtgcgatg gcggcggggg agctcttggc cacccaaaag 301 tgtatataaa cttggacaaa gaaacaaaaa ccggcacatg cggttactgt gggctccagt 361 tcagacagca ccaccactag agcgtgtggc acgccggggg tcccgcagca tcctgtgagc 421 atttccgcgg ggaagctgag cacgtgaagc tcgctggttc tgtgcgaagg gtattcctgg 481 tgctgaataa agggtgttgc tgtcaaggct gaaaaaaaaa aaaaaaaaaa aaaaaaaaaa 541 aaaaaaaa //