LOCUS       BC046155                 548 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa
            (NADH-coenzyme Q reductase), mRNA (cDNA clone MGC:57685
            IMAGE:6047460), complete cds.
ACCESSION   BC046155
VERSION     BC046155.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 548)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 548)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JAN-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Sep 16, 2003 this sequence version replaced BC046155.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 107 Row: l Column: 18.
FEATURES             Location/Qualifiers
     source          1..548
                     /db_xref="H-InvDB:HIT000053004"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:57685 IMAGE:6047460"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_72"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..548
                     /gene="NDUFS6"
                     /db_xref="GeneID:4726"
                     /db_xref="HGNC:HGNC:7713"
                     /db_xref="MIM:603848"
     CDS             6..380
                     /gene="NDUFS6"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 6,
                     13kDa (NADH-coenzyme Q reductase)"
                     /protein_id="AAH46155.1"
                     /db_xref="GeneID:4726"
                     /db_xref="HGNC:HGNC:7713"
                     /db_xref="MIM:603848"
                     /translation="MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQ
                     VYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYIN
                     LDKETKTGTCGYCGLQFRQHHH"
BASE COUNT          150 a          118 c          179 g          101 t
ORIGIN      
        1 gcaaaatggc ggcggcgatg accttctgcc ggctgctgaa ccggtgtggc gaggcggcgc
       61 ggagcctgcc cctgggcgcc aggtgtttcg gggtgcgggt ctcgccgacc ggggagaagg
      121 tcacgcacac tggccaggtt tatgatgata aagactacag gagaattcgg tttgtaggtc
      181 gtcagaaaga ggtgaatgaa aactttgcca ttgatttgat agcagagcag cccgtgagcg
      241 aggtggagac tcgggtgata gcgtgcgatg gcggcggggg agctcttggc cacccaaaag
      301 tgtatataaa cttggacaaa gaaacaaaaa ccggcacatg cggttactgt gggctccagt
      361 tcagacagca ccaccactag agcgtgtggc acgccggggg tcccgcagca tcctgtgagc
      421 atttccgcgg ggaagctgag cacgtgaagc tcgctggttc tgtgcgaagg gtattcctgg
      481 tgctgaataa agggtgttgc tgtcaaggct gaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
      541 aaaaaaaa
//