LOCUS BC033775 1355 bp mRNA linear HUM 27-JAN-2004
DEFINITION Homo sapiens coiled-coil-helix-coiled-coil-helix domain containing
4, mRNA (cDNA clone MGC:45435 IMAGE:4538841), complete cds.
ACCESSION BC033775
VERSION BC033775.1
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1355)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1355)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (02-JUL-2002) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: ATCC
cDNA Library Preparation: Life Technologies, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: National Institutes of Health Intramural
Sequencing Center (NISC),
Gaithersburg, Maryland;
Web site: http://www.nisc.nih.gov/
Contact: nisc_mgc@nhgri.nih.gov
Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
Young,A., Zhang,L.-H. and Green,E.D.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAK Plate: 68 Row: f Column: 1
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 21389468.
FEATURES Location/Qualifiers
source 1..1355
/db_xref="H-InvDB:HIT000041946"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:45435 IMAGE:4538841"
/tissue_type="Testis, embryonal carcinoma"
/clone_lib="NIH_MGC_92"
/lab_host="DH10B"
/note="Vector: pCMV-SPORT6"
gene 1..1355
/gene="CHCHD4"
/gene_synonym="FLJ31709"
/db_xref="GeneID:131474"
CDS 92..520
/gene="CHCHD4"
/gene_synonym="FLJ31709"
/codon_start=1
/product="CHCHD4 protein"
/protein_id="AAH33775.1"
/db_xref="GeneID:131474"
/translation="MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLIL
PNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYP
DLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS"
misc_feature 260..391
/gene="CHCHD4"
/gene_synonym="FLJ31709"
/note="CHCH; Region: CHCH domain. we have identified a
conserved motif in the LOC118487 protein that we have
called the CHCH motif. Alignment of this protein with
related members showed the presence of three subgroups of
proteins, which are called the S (Small), N (N-terminal
extended) and C (C-terminal extended) subgroups. All three
sub-groups of proteins have in common that they contain a
predicted conserved [coiled coil 1]-[helix 1]-[coiled coil
2]-[helix 2] domain (CHCH domain). Within each helix of
the CHCH domain, there are two cysteines present in a
C-X9-C motif. The N-group contains an additional double
helix domain, and each helix contains the C-X9-C motif.
This family contains a number of characterised proteins:
Cox19 protein - a nuclear gene of Saccharomyces
cerevisiae, codes for an 11-kDa protein (Cox19p) required
for expression of cytochrome oxidase. Because cox19
mutants are able to synthesise the mitochondrial and
nuclear gene products of cytochrome oxidase, Cox19p
probably functions post-translationally during assembly of
the enzyme. Cox19p is present in the cytoplasm and
mitochondria, where it exists as a soluble intermembrane
protein. This dual location is similar to what was
previously reported for Cox17p, a low molecular weight
copper protein thought to be required for maturation of
the CuA centre of subunit 2 of cytochrome oxidase. Cox19p
have four conserved potential metal ligands, these are
three cysteines and one histidine. Mrp10 - belongs to the
class of yeast mitochondrial ribosomal proteins that are
essential for translation. Eukaryotic NADH-ubiquinone
oxidoreductase 19 kDa (NDUFA8) subunit"
/db_xref="CDD:pfam06747"
BASE COUNT 402 a 277 c 330 g 346 t
ORIGIN
1 ccacgcgtcc gagaggagag ggaggtcacg gcgtaaaggt gcagctgccg ccaccgccgc
61 ttctgcaagg tctcagggac gggctgcagc catgtcctat tgccggcagg aagggaagga
121 tcgaatcata tttgtaacca aagaagatca tgaaactcca agcagtgcag aattggtggc
181 tgatgacccc aacgatccat acgaggagca tggattgata ctgccaaatg gaaacattaa
241 ctggaactgc ccatgccttg ggggaatggc cagcggtccc tgtggagaac agtttaagtc
301 agccttttcc tgcttccact atagcacgga ggagatcaag gggtcagact gtgtagacca
361 gttccgggcc atgcaggaat gcatgcagaa atacccagac ctctatcccc aagaggatga
421 ggatgaggaa gaggaaagag agaagaagcc agcagaacaa gcagaagaaa cagctcccat
481 tgaggccact gcaaccaaag aagaggaggg atcaagttaa tgaaggccac aaggcactgg
541 gcaccagtcc ttttggagtg gaccttttgc aaaaggcctt gtcatcacct tccaagaaag
601 tttccttctg ttgtcctgtg cattataata tacaaaataa cttattttga tgatcagagg
661 tcttgaggtc ttgacctctt gacatataca ctgaaaaaaa tgggggttgt atgtatgtgt
721 gtcctaccca aacctgtggc cgccactttt gaattctcag attgccctga attttgccac
781 ttttaaataa tgtgctgaat aagctcagca actaaaaacc attacccaag aacgtttctt
841 gtgagtgagc tgatttattc tgattcatta tattcctttt ggtagatttt ataccccttg
901 gggaaataat acaacaaaaa catctcttaa aaatgctggg atggggccat atctactagc
961 agaggccaga tggtcagata tgatttctgc aaacccatct tgaccttgag tatgtgaagg
1021 ggtactgtac tttattcctg atacattttg gtttccatgt aggtgttgag ctcctggttt
1081 tctgtgtttg gatgatgaag atttggaccc ttccattcat aatccctttc taagtgaagg
1141 gagaggctgg cttggctgtt ccttgttatt ccgaaagccc tggtttgggg cccatgttca
1201 cactggctct cagtctagtc aggtgcaatg ttcttgagag gtggggacct aattattacc
1261 agagtagcag caagagagga aacgttgtga attaagtatt caattaaaag gaaacatgat
1321 ttctaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa
//