LOCUS BC031038 1761 bp mRNA linear HUM 30-JUL-2005
DEFINITION Homo sapiens potassium channel tetramerisation domain containing
17, mRNA (cDNA clone MGC:32954 IMAGE:5277700), complete cds.
ACCESSION BC031038
VERSION BC031038.1
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1761)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
CONSRTM Mammalian Gene Collection Program Team
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1761)
CONSRTM NIH MGC Project
TITLE Direct Submission
JOURNAL Submitted (03-JUN-2002) National Institutes of Health, Mammalian
Gene Collection (MGC), Bethesda, MD 20892-2590, USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: Miklos Palkovits, M.D., Ph.D.
cDNA Library Preparation: Michael J. Brownstein (NHGRI) & Shiraki
Toshiyuki and Piero Carninci (RIKEN)
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAK Plate: 48 Row: h Column: 23.
FEATURES Location/Qualifiers
source 1..1761
/db_xref="H-InvDB:HIT000041211"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:32954 IMAGE:5277700"
/tissue_type="Brain, hypothalamus"
/clone_lib="NIH_MGC_96"
/lab_host="DH10B"
/note="Vector: pBluescriptR"
gene 1..1761
/gene="KCTD17"
/gene_synonym="FLJ12242"
/db_xref="GeneID:79734"
CDS 9..953
/gene="KCTD17"
/gene_synonym="FLJ12242"
/codon_start=1
/product="KCTD17 protein"
/protein_id="AAH31038.1"
/db_xref="GeneID:79734"
/translation="MRMEAGEAAPPAGAGGRAAGGWGKWVRLNVGGTVFLTTRQTLCG
EQKSFLSRLCQGEELQSDRDETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEEGVL
EEAEFYNIGPLIRIIKDRMEEKDYTVTQVPPKHVYRVLQCQEEELTQMVSTMSDGWRF
EQLVNIGSSYNYGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEE
EVEEVEVEQVQVEADAQEKAQSSQDPANLFSLPPLPPPPLPAGGSRPHPLRPEAELAV
RASPRPLARPQSCHPCCYKPEAPGCEAPDHLQGLGVPI"
BASE COUNT 335 a 531 c 582 g 313 t
ORIGIN
1 ggcgggcgat gaggatggag gccggggagg cagcgccgcc ggcgggggcg ggcggccgcg
61 ccgcaggcgg ctggggcaag tgggtgcggc tcaacgtggg gggcacggtg ttcctgacca
121 cccggcagac gctgtgcggc gagcagaagt ccttcctcag ccgcctgtgc cagggggaag
181 agctgcagtc ggaccgggat gagaccgggg cctacctcat tgaccgtgac cccacctact
241 tcgggcccat cctgaacttc ctccggcatg gcaagctggt gctggacaag gacatggctg
301 aggagggggt cctggaggaa gccgagttct acaacatcgg cccgctgatc cgcatcatca
361 aagaccggat ggaagagaag gactacacgg tcacccaggt cccacccaag catgtgtacc
421 gcgtgctgca gtgccaggag gaggagctca cgcaaatggt ctcaaccatg tctgatggct
481 ggcgcttcga gcagctggtg aacatcggct cgtcctacaa ctacggcagc gaggaccagg
541 cagagttcct gtgtgtggtg tccaaggagc tccacagcac cccaaacggg ctgagctcag
601 agtccagccg caaaaccaag agcacggagg agcagctgga ggagcagcag cagcaggagg
661 aggaggtgga ggaggtggag gtggaacagg tgcaggtgga ggcagatgca caggagaaag
721 cccagtcatc tcaggatccc gctaaccttt tctccctccc accactgcct cctcctccgc
781 ttcccgctgg aggttcccgt ccgcaccctc tcagacctga ggctgagctt gcagtgaggg
841 cttctcctcg gcccctcgcc cgcccccaga gctgccatcc ctgctgttac aagccagagg
901 cacccggatg tgaggcccca gatcacctcc agggacttgg ggttcccatc tgaaatcctt
961 tatttttgta ccatggggta ggccccgggc ctgagaagga agaagcaccc tctccccggc
1021 ctcctctgtc tgcacccgtg gggctgtgac ttactcctgc ctccaggggc ggggcggggc
1081 ccccctggga cctcttaagg cccaaggtgg gccccaggac ctctgggcag agtggactgc
1141 tcatggcaga tgtgtggcaa tgtctggctg tgtctctccg gcacctgcgt cccctctccc
1201 gggctcccct gctgcatggt ggatgtgctc cttcctggcc cggtcacatt gcctccttga
1261 gccttagtcc agggggtcac tcctcccacc ccacctacct cacagggttg ttgtgagggt
1321 gcacagagga gcaaagtccc tgaaggccct caggcagtat ataggggccg cccaccttca
1381 gctgccctgg gatgggaagg acccagcccg acccctgggc ataacactgt gtttgcaaat
1441 ggagattcag gtattgggga tgcaggttgt ggggagctgg cctggcagag taggggtagt
1501 tggcttggcc ttctctttgg tgatcccacc cccagccatt tgcattgctg gcccagcgcc
1561 tggcctgggg ggcggggaga ggcagcagaa ggggctgggc aggggcggtg gaggactcag
1621 gaactgcccg gggagagtgg gtatggcggc tgagccaggg gccctcctgt gtttgacttc
1681 ccgggatggg tccttgcttc tcagctgtgt ccgaccccac catgtaataa aacccaaagg
1741 aacagcaaaa aaaaaaaaaa a
//