LOCUS BC029560 503 bp mRNA linear HUM 16-AUG-2008 DEFINITION Homo sapiens vacuolar protein sorting 53 homolog (S. cerevisiae), mRNA (cDNA clone IMAGE:4838620), complete cds. ACCESSION BC029560 VERSION BC029560.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 503) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 503) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (01-MAY-2002) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Miklos Palkovits, M.D., Ph.D. cDNA Library Preparation: Michael J. Brownstein (NHGRI) & Shiraki Toshiyuki and Piero Carninci (RIKEN) cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAK Plate: 63 Row: c Column: 6 This clone was selected for full length sequencing because it passed the following selection criteria: Hexamer frequency ORF analysis, GenomeScan gene prediction This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..503 /db_xref="H-InvDB:HIT000040823" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:4838620" /tissue_type="Testis" /clone_lib="NIH_MGC_97" /lab_host="DH10B" /note="Vector: pBluescriptR" gene 1..503 /gene="VPS53" /gene_synonym="HCCS1" /gene_synonym="hVps53L" /gene_synonym="pp13624" /db_xref="GeneID:55275" /db_xref="HGNC:HGNC:25608" CDS 97..483 /gene="VPS53" /gene_synonym="HCCS1" /gene_synonym="hVps53L" /gene_synonym="pp13624" /codon_start=1 /product="VPS53 protein" /protein_id="AAH29560.2" /db_xref="GeneID:55275" /db_xref="HGNC:HGNC:25608" /translation="MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHE PLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGS LSLTAPTPEQESSRIRKLEKLIKKRL" BASE COUNT 138 a 143 c 127 g 95 t ORIGIN 1 aactggaaat gaattccagc ttcccgtcca acttttgtct aaccccgtcc gttgcatgag 61 atgagtttgc tgctgctgga cacccactcg ctgaagatgg tcctgctcga tctcccctcc 121 atcagctcgc aggtggtgag gaaggcaccc gccagctaca ccaagatcgt tgtcaaaggc 181 atgacccggg ctgagatgat cctcaaggta gtgatggccc ctcatgaacc gttggtggtg 241 tttgttgaca actacatcaa acttctcaca gactgcaaca cagaaacctt tcagaagata 301 ctggacatga aggggctgaa gaggagtgag cagagcagca tgctggaact cctgcgccag 361 cggctccccg caccgccctc gggggcagaa agctccggct cactgtccct gacggcgccg 421 acaccagagc aagagtcgtc acgcatccgc aagctcgaga aactcattaa aaagagactg 481 tagcagcaaa aaaaaaaaaa aaa //