LOCUS       BC029560                 503 bp    mRNA    linear   HUM 16-AUG-2008
DEFINITION  Homo sapiens vacuolar protein sorting 53 homolog (S. cerevisiae),
            mRNA (cDNA clone IMAGE:4838620), complete cds.
ACCESSION   BC029560
VERSION     BC029560.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 503)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 503)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAY-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Miklos Palkovits, M.D., Ph.D.
            cDNA Library Preparation: Michael J. Brownstein (NHGRI) &  Shiraki
            Toshiyuki and Piero Carninci (RIKEN)
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 63 Row: c Column: 6
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Hexamer frequency ORF
            analysis, GenomeScan gene prediction
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..503
                     /db_xref="H-InvDB:HIT000040823"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4838620"
                     /tissue_type="Testis"
                     /clone_lib="NIH_MGC_97"
                     /lab_host="DH10B"
                     /note="Vector: pBluescriptR"
     gene            1..503
                     /gene="VPS53"
                     /gene_synonym="HCCS1"
                     /gene_synonym="hVps53L"
                     /gene_synonym="pp13624"
                     /db_xref="GeneID:55275"
                     /db_xref="HGNC:HGNC:25608"
     CDS             97..483
                     /gene="VPS53"
                     /gene_synonym="HCCS1"
                     /gene_synonym="hVps53L"
                     /gene_synonym="pp13624"
                     /codon_start=1
                     /product="VPS53 protein"
                     /protein_id="AAH29560.2"
                     /db_xref="GeneID:55275"
                     /db_xref="HGNC:HGNC:25608"
                     /translation="MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHE
                     PLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGS
                     LSLTAPTPEQESSRIRKLEKLIKKRL"
BASE COUNT          138 a          143 c          127 g           95 t
ORIGIN      
        1 aactggaaat gaattccagc ttcccgtcca acttttgtct aaccccgtcc gttgcatgag
       61 atgagtttgc tgctgctgga cacccactcg ctgaagatgg tcctgctcga tctcccctcc
      121 atcagctcgc aggtggtgag gaaggcaccc gccagctaca ccaagatcgt tgtcaaaggc
      181 atgacccggg ctgagatgat cctcaaggta gtgatggccc ctcatgaacc gttggtggtg
      241 tttgttgaca actacatcaa acttctcaca gactgcaaca cagaaacctt tcagaagata
      301 ctggacatga aggggctgaa gaggagtgag cagagcagca tgctggaact cctgcgccag
      361 cggctccccg caccgccctc gggggcagaa agctccggct cactgtccct gacggcgccg
      421 acaccagagc aagagtcgtc acgcatccgc aagctcgaga aactcattaa aaagagactg
      481 tagcagcaaa aaaaaaaaaa aaa
//