LOCUS BC028179 1424 bp mRNA linear HUM 15-JUL-2006 DEFINITION Homo sapiens eukaryotic translation elongation factor 1 gamma, mRNA (cDNA clone MGC:40101 IMAGE:5402023), complete cds. ACCESSION BC028179 VERSION BC028179.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1424) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 1424) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (08-APR-2002) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC cDNA Library Preparation: Life Technologies, Inc. cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: National Institutes of Health Intramural Sequencing Center (NISC), Gaithersburg, Maryland; Web site: http://www.nisc.nih.gov/ Contact: nisc_mgc@nhgri.nih.gov Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B., Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S., Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P., Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R., Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C., McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W., Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L., Young,A., Zhang,L.-H. and Green,E.D. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAK Plate: 62 Row: p Column: 15 This clone was selected for full length sequencing because it passed the following selection criteria: Similarity but not identity to protein. FEATURES Location/Qualifiers source 1..1424 /db_xref="H-InvDB:HIT000040479" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:40101 IMAGE:5402023" /tissue_type="Liver, adenocarcinoma" /clone_lib="NIH_MGC_90" /lab_host="DH10B" /note="Vector: pCMV-SPORT6" gene 1..1424 /gene="EEF1G" /gene_synonym="EF1G" /gene_synonym="GIG35" /db_xref="GeneID:1937" /db_xref="HGNC:HGNC:3213" /db_xref="MIM:130593" CDS 19..1332 /gene="EEF1G" /gene_synonym="EF1G" /gene_synonym="GIG35" /codon_start=1 /product="eukaryotic translation elongation factor 1 gamma" /protein_id="AAH28179.1" /db_xref="GeneID:1937" /db_xref="HGNC:HGNC:3213" /db_xref="MIM:130593" /translation="MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTN RTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFA DSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLA DITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDA KKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKA KDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQ TFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQV DYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK" BASE COUNT 349 a 375 c 392 g 308 t ORIGIN 1 ccacgcgtcc gaatcaccat ggcggctggg accctgtaca cgtatcctga aaactggagg 61 gccttcaagg ctctcatcgc tgctcagtac agcggggctc aggtccgcgt gctctccgca 121 ccaccccact tccattttgg ccaaaccaac cgcacccctg aatttctccg caaatttcct 181 gccggcaagg tcccagcatt tgagggtgat gatggattct gtgtgtttga gagcaacgcc 241 attgcctact atgtgagcaa tgaggagctg cggggaagta ctccagaggc agcagcccag 301 gtggtgcagt gggtgagctt tgctgattcc gatatagtgc ccccagccag tacctgggtg 361 ttccccacct tgggcatcat gcaccacaac aaacaggcca ctgagaatgc aaaggaggaa 421 gtgaggcgaa ttctggggct gctggatgct tacttgaaga cgaggacttt tctggtgggc 481 gaacgagtga cattggctga catcacagtt gtctgcaccc tgttgtggct ctataagcag 541 gttctagagc cttctttccg ccaggccttt cccaatacca accgctggtt cctcacctgc 601 attaaccagc cccagttccg ggctgtcttg ggcgaagtga aactgtgtga gaagatggcc 661 cagtttgatg ctaaaaagtt tgcagagacc caacctaaaa aggacacacc acggaaagag 721 aagggttcac gggaagagaa gcagaagccc caggctgagc ggaaggagga gaaaaaggcg 781 gctgcccctg ctcctgagga ggagatggat gaatgtgagc aggcgctggc tgctgagccc 841 aaggccaagg accccttcgc tcacctgccc aagagtacct ttgtgttgga tgaatttaag 901 cgcaagtact ccaatgagga cacactctct gtggcactgc catatttctg ggagcacttt 961 gataaggacg gctggtccct gtggtactca gagtatcgct tccctgaaga actcactcag 1021 accttcatga gctgcaatct catcactgga atgttccagc gactggacaa gctgaggaag 1081 aatgccttcg ccagtgtcat cctttttgga accaacaata gcagctccat ttctggagtc 1141 tgggtcttcc gaggccagga gcttgccttt ccgctgagtc cagattggca ggtggactac 1201 gagtcataca catggcggaa actggatcct ggcagcgagg agacccagac gctggttcga 1261 gagtactttt cctgggaggg ggccttccag catgtgggca aagccttcaa tcagggcaag 1321 atcttcaagt gaacatctct tgccatcacc tagctgcctg cacctgccct tcagggagat 1381 gggggtcatt aaaggaaact gaacattgaa aaaaaaaaaa aaaa //