LOCUS       BC028179                1424 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens eukaryotic translation elongation factor 1 gamma, mRNA
            (cDNA clone MGC:40101 IMAGE:5402023), complete cds.
ACCESSION   BC028179
VERSION     BC028179.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1424)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1424)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (08-APR-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 62 Row: p Column: 15
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Similarity but not
            identity to protein.
FEATURES             Location/Qualifiers
     source          1..1424
                     /db_xref="H-InvDB:HIT000040479"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:40101 IMAGE:5402023"
                     /tissue_type="Liver, adenocarcinoma"
                     /clone_lib="NIH_MGC_90"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1424
                     /gene="EEF1G"
                     /gene_synonym="EF1G"
                     /gene_synonym="GIG35"
                     /db_xref="GeneID:1937"
                     /db_xref="HGNC:HGNC:3213"
                     /db_xref="MIM:130593"
     CDS             19..1332
                     /gene="EEF1G"
                     /gene_synonym="EF1G"
                     /gene_synonym="GIG35"
                     /codon_start=1
                     /product="eukaryotic translation elongation factor 1
                     gamma"
                     /protein_id="AAH28179.1"
                     /db_xref="GeneID:1937"
                     /db_xref="HGNC:HGNC:3213"
                     /db_xref="MIM:130593"
                     /translation="MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTN
                     RTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFA
                     DSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLA
                     DITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDA
                     KKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKA
                     KDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQ
                     TFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQV
                     DYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK"
BASE COUNT          349 a          375 c          392 g          308 t
ORIGIN      
        1 ccacgcgtcc gaatcaccat ggcggctggg accctgtaca cgtatcctga aaactggagg
       61 gccttcaagg ctctcatcgc tgctcagtac agcggggctc aggtccgcgt gctctccgca
      121 ccaccccact tccattttgg ccaaaccaac cgcacccctg aatttctccg caaatttcct
      181 gccggcaagg tcccagcatt tgagggtgat gatggattct gtgtgtttga gagcaacgcc
      241 attgcctact atgtgagcaa tgaggagctg cggggaagta ctccagaggc agcagcccag
      301 gtggtgcagt gggtgagctt tgctgattcc gatatagtgc ccccagccag tacctgggtg
      361 ttccccacct tgggcatcat gcaccacaac aaacaggcca ctgagaatgc aaaggaggaa
      421 gtgaggcgaa ttctggggct gctggatgct tacttgaaga cgaggacttt tctggtgggc
      481 gaacgagtga cattggctga catcacagtt gtctgcaccc tgttgtggct ctataagcag
      541 gttctagagc cttctttccg ccaggccttt cccaatacca accgctggtt cctcacctgc
      601 attaaccagc cccagttccg ggctgtcttg ggcgaagtga aactgtgtga gaagatggcc
      661 cagtttgatg ctaaaaagtt tgcagagacc caacctaaaa aggacacacc acggaaagag
      721 aagggttcac gggaagagaa gcagaagccc caggctgagc ggaaggagga gaaaaaggcg
      781 gctgcccctg ctcctgagga ggagatggat gaatgtgagc aggcgctggc tgctgagccc
      841 aaggccaagg accccttcgc tcacctgccc aagagtacct ttgtgttgga tgaatttaag
      901 cgcaagtact ccaatgagga cacactctct gtggcactgc catatttctg ggagcacttt
      961 gataaggacg gctggtccct gtggtactca gagtatcgct tccctgaaga actcactcag
     1021 accttcatga gctgcaatct catcactgga atgttccagc gactggacaa gctgaggaag
     1081 aatgccttcg ccagtgtcat cctttttgga accaacaata gcagctccat ttctggagtc
     1141 tgggtcttcc gaggccagga gcttgccttt ccgctgagtc cagattggca ggtggactac
     1201 gagtcataca catggcggaa actggatcct ggcagcgagg agacccagac gctggttcga
     1261 gagtactttt cctgggaggg ggccttccag catgtgggca aagccttcaa tcagggcaag
     1321 atcttcaagt gaacatctct tgccatcacc tagctgcctg cacctgccct tcagggagat
     1381 gggggtcatt aaaggaaact gaacattgaa aaaaaaaaaa aaaa
//