LOCUS BC022042 540 bp mRNA linear HUM 09-JUN-2008 DEFINITION Homo sapiens Mdm1 nuclear protein homolog (mouse), mRNA (cDNA clone IMAGE:4670016), complete cds. ACCESSION BC022042 VERSION BC022042.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 540) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 540) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (22-JAN-2002) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: DCTD/DTP cDNA Library Preparation: CLONTECH Laboratories, Inc. cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Institute for Systems Biology http://www.systemsbiology.org contact: amadan@systemsbiology.org Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 38 Row: h Column: 2 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 9910417 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..540 /db_xref="H-InvDB:HIT000039369" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:4670016" /tissue_type="Prostate, adenocarcinoma." /clone_lib="NIH_MGC_60" /lab_host="DH10B" /note="Vector: pDNR-LIB" gene 1..540 /gene="MDM1" /db_xref="GeneID:56890" /db_xref="HGNC:HGNC:29917" CDS 57..266 /gene="MDM1" /codon_start=1 /product="MDM1 protein" /protein_id="AAH22042.1" /db_xref="GeneID:56890" /db_xref="HGNC:HGNC:29917" /translation="MPVRFKGLSEYQRNFLWKKSYLSESCNSSVGRKYPWAGLRSDQL GNQGRCRTKIQHSDISSLLILVCST" BASE COUNT 166 a 102 c 123 g 149 t ORIGIN 1 gggggctttt tctccagtta actgtcggag tagcgggggc tccggcgccg ggcgacatgc 61 cggtgcgctt caaggggctg agtgaatacc agaggaactt cctgtggaaa aagtcttatt 121 tgtcagagtc ttgtaattcc tccgtggggc gaaagtaccc atgggctgga cttagatcag 181 atcaattagg aaatcaaggc agatgtagaa ccaagatcca gcacagtgac atctcatccc 241 ttctcatctt ggtctgctcc acataagaga agctttgtga aaagttccaa attttgacag 301 taccaggccc attgttctgt taagtagcac aggaaagtaa ttagaaacga ggcagcatgt 361 actgcctggc ctgccaggtc tatcacgttg caattctagt gacttttgtt aggataactg 421 gaacattttg tgaccccccg atttttaatt ttttgttatg gtcaaatttt taatgctttt 481 aaaagcaaaa ttaaatattt tatgttgaag aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa //