LOCUS       BC022042                 540 bp    mRNA    linear   HUM 09-JUN-2008
DEFINITION  Homo sapiens Mdm1 nuclear protein homolog (mouse), mRNA (cDNA clone
            IMAGE:4670016), complete cds.
ACCESSION   BC022042
VERSION     BC022042.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 540)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 540)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JAN-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 38 Row: h Column: 2
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 9910417
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..540
                     /db_xref="H-InvDB:HIT000039369"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4670016"
                     /tissue_type="Prostate, adenocarcinoma."
                     /clone_lib="NIH_MGC_60"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            1..540
                     /gene="MDM1"
                     /db_xref="GeneID:56890"
                     /db_xref="HGNC:HGNC:29917"
     CDS             57..266
                     /gene="MDM1"
                     /codon_start=1
                     /product="MDM1 protein"
                     /protein_id="AAH22042.1"
                     /db_xref="GeneID:56890"
                     /db_xref="HGNC:HGNC:29917"
                     /translation="MPVRFKGLSEYQRNFLWKKSYLSESCNSSVGRKYPWAGLRSDQL
                     GNQGRCRTKIQHSDISSLLILVCST"
BASE COUNT          166 a          102 c          123 g          149 t
ORIGIN      
        1 gggggctttt tctccagtta actgtcggag tagcgggggc tccggcgccg ggcgacatgc
       61 cggtgcgctt caaggggctg agtgaatacc agaggaactt cctgtggaaa aagtcttatt
      121 tgtcagagtc ttgtaattcc tccgtggggc gaaagtaccc atgggctgga cttagatcag
      181 atcaattagg aaatcaaggc agatgtagaa ccaagatcca gcacagtgac atctcatccc
      241 ttctcatctt ggtctgctcc acataagaga agctttgtga aaagttccaa attttgacag
      301 taccaggccc attgttctgt taagtagcac aggaaagtaa ttagaaacga ggcagcatgt
      361 actgcctggc ctgccaggtc tatcacgttg caattctagt gacttttgtt aggataactg
      421 gaacattttg tgaccccccg atttttaatt ttttgttatg gtcaaatttt taatgctttt
      481 aaaagcaaaa ttaaatattt tatgttgaag aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
//