LOCUS BC017846 282 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens cDNA clone IMAGE:4273542, partial cds. ACCESSION BC017846 VERSION BC017846.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 282) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 282) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (03-DEC-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: CLONTECH cDNA Library Preparation: CLONTECH Laboratories, Inc. cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 35 Row: i Column: 2 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 5032188. FEATURES Location/Qualifiers source 1..282 /db_xref="H-InvDB:HIT000089426" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:4273542" /tissue_type="Prostate" /clone_lib="NIH_MGC_83" /lab_host="DH10B" /note="Vector: pDNR-LIB" CDS 94..>282 /codon_start=1 /product="Unknown (protein for IMAGE:4273542)" /protein_id="AAH17846.1" /translation="MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLS RHLPNLQTHKKKKKKKKKK" BASE COUNT 87 a 66 c 69 g 60 t ORIGIN 1 cgacctaggg atcgatctgg agggacttgg ggagcgtgca gagacctcta gctcgagcgc 61 gagggacctc ccgccgggat gcctggggag cagatggacc ctactggaag tcagttggat 121 tcagatttct ctcagcaaga tactccttgc ctgataattg aagattctca gcctgaaagc 181 caggttctag aggatgattc tggttctcac ttcagtatgc tatctcgaca ccttcctaat 241 ctccagacgc acaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa //