LOCUS       BC017243                 493 bp    mRNA    linear   HUM 11-SEP-2007
DEFINITION  Homo sapiens mitochondrial translational initiation factor 2, mRNA
            (cDNA clone IMAGE:4544597), partial cds.
ACCESSION   BC017243
VERSION     BC017243.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 493)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 493)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-NOV-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 39 Row: c Column: 23
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 53729336.
FEATURES             Location/Qualifiers
     source          1..493
                     /db_xref="H-InvDB:HIT000089221"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4544597"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_20"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..>493
                     /gene="MTIF2"
                     /db_xref="GeneID:4528"
                     /db_xref="HGNC:HGNC:7441"
                     /db_xref="MIM:603766"
     CDS             265..>493
                     /gene="MTIF2"
                     /codon_start=1
                     /product="MTIF2 protein"
                     /protein_id="AAH17243.1"
                     /db_xref="GeneID:4528"
                     /db_xref="HGNC:HGNC:7441"
                     /db_xref="MIM:603766"
                     /translation="MNQKLLKLENLLRFHTIYRQLHSLCQRRALRQWRHGFSSAYPVW
                     TAQLCAWPWPTDVLNGAALSQYRLLVTKKKKK"
BASE COUNT          144 a          103 c          122 g          124 t
ORIGIN      
        1 ctcagaatcc aggggcccgg ggctgtagat tccttgacaa ggatatccta gcggcgaaac
       61 aacaccgtac tgggagtcag aacgtctggg ttctagtctt gactgccatt aactagcggt
      121 atgacattgg agaagctttt ttgacccttc tggatttccg tttccttttc tgtaaaatga
      181 ggagcttgga agatccggaa aatgaggccc ataggaaaca agtgacttgc tgagtccaga
      241 taacactgac tgtcagagag aaacatgaac cagaagctac tgaagttgga gaacttgcta
      301 cgatttcaca ctatttatag gcaactgcac agtctgtgtc aaagaagagc attaagacag
      361 tggaggcatg ggttttcatc tgcttaccct gtgtggacag ctcaactgtg tgcctggccc
      421 tggccaacag atgtgctcaa tggggctgct ttatctcagt ataggcttct agtaacaaaa
      481 aaaaaaaaaa aaa
//