LOCUS BC017243 493 bp mRNA linear HUM 11-SEP-2007 DEFINITION Homo sapiens mitochondrial translational initiation factor 2, mRNA (cDNA clone IMAGE:4544597), partial cds. ACCESSION BC017243 VERSION BC017243.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 493) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 493) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (05-NOV-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC/DCTD/DTP cDNA Library Preparation: Rubin Laboratory cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: National Institutes of Health Intramural Sequencing Center (NISC), Gaithersburg, Maryland; Web site: http://www.nisc.nih.gov/ Contact: nisc_mgc@nhgri.nih.gov Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B., Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S., Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P., Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R., Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C., McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W., Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L., Young,A., Zhang,L.-H. and Green,E.D. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 39 Row: c Column: 23 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 53729336. FEATURES Location/Qualifiers source 1..493 /db_xref="H-InvDB:HIT000089221" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:4544597" /tissue_type="Skin, melanotic melanoma." /clone_lib="NIH_MGC_20" /lab_host="DH10B-R" /note="Vector: pOTB7" gene 1..>493 /gene="MTIF2" /db_xref="GeneID:4528" /db_xref="HGNC:HGNC:7441" /db_xref="MIM:603766" CDS 265..>493 /gene="MTIF2" /codon_start=1 /product="MTIF2 protein" /protein_id="AAH17243.1" /db_xref="GeneID:4528" /db_xref="HGNC:HGNC:7441" /db_xref="MIM:603766" /translation="MNQKLLKLENLLRFHTIYRQLHSLCQRRALRQWRHGFSSAYPVW TAQLCAWPWPTDVLNGAALSQYRLLVTKKKKK" BASE COUNT 144 a 103 c 122 g 124 t ORIGIN 1 ctcagaatcc aggggcccgg ggctgtagat tccttgacaa ggatatccta gcggcgaaac 61 aacaccgtac tgggagtcag aacgtctggg ttctagtctt gactgccatt aactagcggt 121 atgacattgg agaagctttt ttgacccttc tggatttccg tttccttttc tgtaaaatga 181 ggagcttgga agatccggaa aatgaggccc ataggaaaca agtgacttgc tgagtccaga 241 taacactgac tgtcagagag aaacatgaac cagaagctac tgaagttgga gaacttgcta 301 cgatttcaca ctatttatag gcaactgcac agtctgtgtc aaagaagagc attaagacag 361 tggaggcatg ggttttcatc tgcttaccct gtgtggacag ctcaactgtg tgcctggccc 421 tggccaacag atgtgctcaa tggggctgct ttatctcagt ataggcttct agtaacaaaa 481 aaaaaaaaaa aaa //