LOCUS BC017082 1344 bp mRNA linear HUM 27-JAN-2004
DEFINITION Homo sapiens coiled-coil-helix-coiled-coil-helix domain containing
4, mRNA (cDNA clone MGC:9700 IMAGE:3848900), complete cds.
ACCESSION BC017082
VERSION BC017082.1
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1344)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1344)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (05-NOV-2001) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: ATCC
cDNA Library Preparation: Life Technologies, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAK Plate: 20 Row: k Column: 7.
FEATURES Location/Qualifiers
source 1..1344
/db_xref="H-InvDB:HIT000050667"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:9700 IMAGE:3848900"
/tissue_type="Colon, adenocarcinoma"
/clone_lib="NIH_MGC_65"
/lab_host="DH10B"
/note="Vector: pCMV-SPORT6"
gene 1..1344
/gene="CHCHD4"
/gene_synonym="FLJ31709"
/db_xref="GeneID:131474"
CDS 64..492
/gene="CHCHD4"
/gene_synonym="FLJ31709"
/codon_start=1
/product="CHCHD4 protein"
/protein_id="AAH17082.2"
/db_xref="GeneID:131474"
/translation="MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLIL
PNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYP
DLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS"
misc_feature 232..363
/gene="CHCHD4"
/gene_synonym="FLJ31709"
/note="CHCH; Region: CHCH domain. we have identified a
conserved motif in the LOC118487 protein that we have
called the CHCH motif. Alignment of this protein with
related members showed the presence of three subgroups of
proteins, which are called the S (Small), N (N-terminal
extended) and C (C-terminal extended) subgroups. All three
sub-groups of proteins have in common that they contain a
predicted conserved [coiled coil 1]-[helix 1]-[coiled coil
2]-[helix 2] domain (CHCH domain). Within each helix of
the CHCH domain, there are two cysteines present in a
C-X9-C motif. The N-group contains an additional double
helix domain, and each helix contains the C-X9-C motif.
This family contains a number of characterised proteins:
Cox19 protein - a nuclear gene of Saccharomyces
cerevisiae, codes for an 11-kDa protein (Cox19p) required
for expression of cytochrome oxidase. Because cox19
mutants are able to synthesise the mitochondrial and
nuclear gene products of cytochrome oxidase, Cox19p
probably functions post-translationally during assembly of
the enzyme. Cox19p is present in the cytoplasm and
mitochondria, where it exists as a soluble intermembrane
protein. This dual location is similar to what was
previously reported for Cox17p, a low molecular weight
copper protein thought to be required for maturation of
the CuA centre of subunit 2 of cytochrome oxidase. Cox19p
have four conserved potential metal ligands, these are
three cysteines and one histidine. Mrp10 - belongs to the
class of yeast mitochondrial ribosomal proteins that are
essential for translation. Eukaryotic NADH-ubiquinone
oxidoreductase 19 kDa (NDUFA8) subunit"
/db_xref="CDD:pfam06747"
BASE COUNT 409 a 271 c 319 g 345 t
ORIGIN
1 cggcgtaaag gtgcagctgc cgccaccgcc gcttctgcaa ggtctcaggg acgggctgca
61 gccatgtcct attgccggca ggaagggaag gatcgaatca tatttgtaac caaagaagat
121 catgaaactc caagcagtgc agaattggtg gctgatgacc ccaacgatcc atacgaggag
181 catggattga tactgccaaa tggaaacatt aactggaact gcccatgcct tgggggaatg
241 gccagcggtc cctgtggaga acagtttaag tcagcctttt cctgcttcca ctatagcacg
301 gaggagatca aggggtcaga ctgtgtagac cagttccggg ccatgcagga atgcatgcag
361 aaatacccag acctctatcc ccaagaggat gaggatgagg aagaggaaag agagaagaag
421 ccagcagaac aagcagaaga aacagctccc attgaggcca ctgcaaccaa agaagaggag
481 ggatcaagtt aatgaaggcc acaaggcact gggcaccagt ccttttggag tggacctttt
541 gcaaaaggcc ttgtcatcac cttccaagaa agtttccttc tgttgtcctg tgcattataa
601 tatacaaaat aacttatttt gatgatcaga ggtcttgagg tcttgacatc ttgacatata
661 cactgaaaaa aatgggggtt gtatgtatgt gtgtcctacc caaacctgtg gccgccactt
721 ttgaattctc agattgccct gaattttgcc acttttaaat aatgtgctga ataagctcag
781 caactaaaaa ccattaccca agaacgtttc ttgtgagtga gctgatttat tctgattcat
841 tatattcctt ttggtagatt ttatacccct tggggaaata atacaacaaa aacatctctt
901 aaaaatgctg ggatggggcc atatctacta gcagaggcca gatggtcaga tatgatttct
961 gcaaacccat cttgaccttg agtatgtgaa ggggtactgt actttattcc tgatacattt
1021 tggtttccat gtaggtgttg agctcctggt tttctgtgtt tggatgatga agatttggac
1081 ccttccattc ataatccctt tctaagtgaa gggagaggct ggcttggctg ttccttgtta
1141 ttccgaaagc cctggtttgg ggcccatgtt cacactggct ctcagtctag tcaggtgcaa
1201 tgttcttgag aggtggggac ctaattatta ccagagtagc agcaagagag gaaacgttgt
1261 gaattaagta ttcaattaaa aggaaacatg atttctacct gaaaaaaaaa aaaaaaaaaa
1321 aaaaaaaaaa aaaaaaaaaa aaaa
//