LOCUS BC014386 721 bp mRNA linear HUM 16-SEP-2003 DEFINITION Homo sapiens protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform, mRNA (cDNA clone IMAGE:3508805), complete cds. ACCESSION BC014386 VERSION BC014386.2 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 721) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 721) AUTHORS Strausberg,R. TITLE Direct Submission JOURNAL Submitted (17-SEP-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Cancer Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT On Aug 19, 2003 this sequence version replaced BC014386.1. Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC cDNA Library Preparation: Rubin Laboratory cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Institute for Systems Biology http://www.systemsbiology.org contact: amadan@systemsbiology.org Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 7 Row: n Column: 8 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..721 /db_xref="H-InvDB:HIT000050594" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:3508805" /tissue_type="Brain, neuroblastoma" /clone_lib="NIH_MGC_19" /lab_host="DH10B-R" /note="Vector: pOTB7" gene 1..721 /gene="PPM1G" /gene_synonym="MGC1675" /gene_synonym="MGC2870" /gene_synonym="PP2CG" /gene_synonym="PP2CGAMMA" /gene_synonym="PPP2CG" /db_xref="GeneID:5496" /db_xref="MIM:605119" CDS 54..158 /gene="PPM1G" /gene_synonym="MGC1675" /gene_synonym="MGC2870" /gene_synonym="PP2CG" /gene_synonym="PP2CGAMMA" /gene_synonym="PPP2CG" /codon_start=1 /product="PPM1G protein" /protein_id="AAH14386.2" /db_xref="GeneID:5496" /db_xref="MIM:605119" /translation="MKMGSFGYCHPLWKSCWISAWHQTLLGMVQGVTT" BASE COUNT 175 a 184 c 187 g 175 t ORIGIN 1 gatgagcagc caggaagttg tagatttcat tcaatcaaag atcagccagc gtgatgaaaa 61 tggggagctt cggttattgt catccattgt ggaagagctg ctggatcagt gcctggcacc 121 agacacttct ggggatggta cagggtgtga caacatgacc tgcatcatca tttgcttcaa 181 gccccgaaac acagcagagc tccagccaga gagtggcaag cgaaaactag aggaggtgct 241 ctctactgag ggggctgaag aaaatggcaa cagcgacaag aagaagaagg ccaagcgaga 301 ctagcagtca tccagacccc tgcccaccta gactgttttc tgagccctcc ggacctgaga 361 ctgagttttg tctttttcct ttagccttag cagtgggtat gaggtgtgca gggggagctg 421 ggtggcttca ctccgcccat tccaaagagg gctctccctc cacactgcag ccgggagcct 481 ctgctgtcct ccccagccgc ctctgctcct cgggctcatc accggttctg tgcctgtgct 541 ctgttgtgtt ggagggaagg actggcggtt ctggttttta ctctgtgaac tttatttaag 601 gacattcttt tttattggcg gctccatggc cctcggccgc ttgcacccgc tctctgttgt 661 acactttcaa tcaacacttt ttcagactaa aggccaaaac ctaaaaaaaa aaaaaaaaaa 721 a //