LOCUS       BC014386                 721 bp    mRNA    linear   HUM 16-SEP-2003
DEFINITION  Homo sapiens protein phosphatase 1G (formerly 2C),
            magnesium-dependent, gamma isoform, mRNA (cDNA clone
            IMAGE:3508805), complete cds.
ACCESSION   BC014386
VERSION     BC014386.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 721)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 721)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-SEP-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC014386.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 7 Row: n Column: 8
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..721
                     /db_xref="H-InvDB:HIT000050594"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3508805"
                     /tissue_type="Brain, neuroblastoma"
                     /clone_lib="NIH_MGC_19"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..721
                     /gene="PPM1G"
                     /gene_synonym="MGC1675"
                     /gene_synonym="MGC2870"
                     /gene_synonym="PP2CG"
                     /gene_synonym="PP2CGAMMA"
                     /gene_synonym="PPP2CG"
                     /db_xref="GeneID:5496"
                     /db_xref="MIM:605119"
     CDS             54..158
                     /gene="PPM1G"
                     /gene_synonym="MGC1675"
                     /gene_synonym="MGC2870"
                     /gene_synonym="PP2CG"
                     /gene_synonym="PP2CGAMMA"
                     /gene_synonym="PPP2CG"
                     /codon_start=1
                     /product="PPM1G protein"
                     /protein_id="AAH14386.2"
                     /db_xref="GeneID:5496"
                     /db_xref="MIM:605119"
                     /translation="MKMGSFGYCHPLWKSCWISAWHQTLLGMVQGVTT"
BASE COUNT          175 a          184 c          187 g          175 t
ORIGIN      
        1 gatgagcagc caggaagttg tagatttcat tcaatcaaag atcagccagc gtgatgaaaa
       61 tggggagctt cggttattgt catccattgt ggaagagctg ctggatcagt gcctggcacc
      121 agacacttct ggggatggta cagggtgtga caacatgacc tgcatcatca tttgcttcaa
      181 gccccgaaac acagcagagc tccagccaga gagtggcaag cgaaaactag aggaggtgct
      241 ctctactgag ggggctgaag aaaatggcaa cagcgacaag aagaagaagg ccaagcgaga
      301 ctagcagtca tccagacccc tgcccaccta gactgttttc tgagccctcc ggacctgaga
      361 ctgagttttg tctttttcct ttagccttag cagtgggtat gaggtgtgca gggggagctg
      421 ggtggcttca ctccgcccat tccaaagagg gctctccctc cacactgcag ccgggagcct
      481 ctgctgtcct ccccagccgc ctctgctcct cgggctcatc accggttctg tgcctgtgct
      541 ctgttgtgtt ggagggaagg actggcggtt ctggttttta ctctgtgaac tttatttaag
      601 gacattcttt tttattggcg gctccatggc cctcggccgc ttgcacccgc tctctgttgt
      661 acactttcaa tcaacacttt ttcagactaa aggccaaaac ctaaaaaaaa aaaaaaaaaa
      721 a
//