LOCUS       BC009836                 949 bp    mRNA    linear   HUM 21-OCT-2003
DEFINITION  Homo sapiens peroxisomal membrane protein 2, 22kDa, mRNA (cDNA
            clone IMAGE:4098463), complete cds.
ACCESSION   BC009836
VERSION     BC009836.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 949)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 949)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 25 Row: p Column: 16
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 8923891
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..949
                     /db_xref="H-InvDB:HIT000034608"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4098463"
                     /tissue_type="Muscle, rhabdomyosarcoma"
                     /clone_lib="NIH_MGC_17"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..949
                     /gene="PXMP2"
                     /gene_synonym="PMP22"
                     /db_xref="GeneID:5827"
     CDS             410..640
                     /gene="PXMP2"
                     /gene_synonym="PMP22"
                     /codon_start=1
                     /product="PXMP2 protein"
                     /protein_id="AAH09836.1"
                     /db_xref="GeneID:5827"
                     /translation="MLMNCSGVHTRQFILSAGQKPPLILAAKAEASFPSRKFMMRKNN
                     MRKAGAKTRRSRRSLLSPARGTSGGIQCSMKK"
BASE COUNT          208 a          268 c          257 g          216 t
ORIGIN      
        1 tttttttttt tttttttttt tttttgaaga acctgcatta tcgtttattg tgatcctaat
       61 tcggtccaca gtaacaattg aaactgcctc gactaaattt taagtttctg gggcagcacc
      121 acctgaaggc agtgactgcc tttttaaaag acagggttct gacattcaga gatttctgtt
      181 tctctatcca tcatttttgg gcatcttgaa tcacctgatt tagagtcagt gacatcctga
      241 ctggattggt tctgctctcg ctgggcgggt gagaccccca gacccacgtc cacagtgcac
      301 ctgatgttct cccagcggtc gtcacttccc caaggaggcc aggtaggcat accagaacag
      361 agctgccagg ttggcgaaga gcacccggaa cttcagaggg acgtagttga tgttgatgaa
      421 ctgtagtggc gtccacaccc gccagttcat cctcagcgcc ggccagaagc cccccctcat
      481 cttggcggcg aaggctgagg cgtctttccc ctccagaaag ttcatgatga ggaagaacaa
      541 catgaggaag gccggtgcaa agacgaggcg gtccaggaga agcctcctga gccctgccag
      601 ggggacctca ggagggatcc aatgttccat gaagaagtag aagaagtgac tcagcggccc
      661 tgtgaagaag aacccgtaaa cggcatatct cagaggccca ccgacatcca gacttctaga
      721 gttttctttt ttccgcttct tctcaatcat gctgggccag gaagttccca agtgctgaca
      781 aaatgccact ggtggccgcc ttggtgagca ccgggtagag ccgcaggaag agcaagtact
      841 gggcgagcgc ccgccgcggc agcgccccga gcccggcttc ggcccgcagc ctggacgcgg
      901 ccggcgccat cgcctcccca gcgccgtgcc gccgggggca cctcgtgcc
//