LOCUS BC009836 949 bp mRNA linear HUM 21-OCT-2003 DEFINITION Homo sapiens peroxisomal membrane protein 2, 22kDa, mRNA (cDNA clone IMAGE:4098463), complete cds. ACCESSION BC009836 VERSION BC009836.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 949) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 949) AUTHORS Strausberg,R. TITLE Direct Submission JOURNAL Submitted (02-JUL-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Cancer Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC cDNA Library Preparation: Rubin Laboratory cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Institute for Systems Biology http://www.systemsbiology.org contact: amadan@systemsbiology.org Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 25 Row: p Column: 16 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 8923891 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..949 /db_xref="H-InvDB:HIT000034608" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:4098463" /tissue_type="Muscle, rhabdomyosarcoma" /clone_lib="NIH_MGC_17" /lab_host="DH10B-R" /note="Vector: pOTB7" gene 1..949 /gene="PXMP2" /gene_synonym="PMP22" /db_xref="GeneID:5827" CDS 410..640 /gene="PXMP2" /gene_synonym="PMP22" /codon_start=1 /product="PXMP2 protein" /protein_id="AAH09836.1" /db_xref="GeneID:5827" /translation="MLMNCSGVHTRQFILSAGQKPPLILAAKAEASFPSRKFMMRKNN MRKAGAKTRRSRRSLLSPARGTSGGIQCSMKK" BASE COUNT 208 a 268 c 257 g 216 t ORIGIN 1 tttttttttt tttttttttt tttttgaaga acctgcatta tcgtttattg tgatcctaat 61 tcggtccaca gtaacaattg aaactgcctc gactaaattt taagtttctg gggcagcacc 121 acctgaaggc agtgactgcc tttttaaaag acagggttct gacattcaga gatttctgtt 181 tctctatcca tcatttttgg gcatcttgaa tcacctgatt tagagtcagt gacatcctga 241 ctggattggt tctgctctcg ctgggcgggt gagaccccca gacccacgtc cacagtgcac 301 ctgatgttct cccagcggtc gtcacttccc caaggaggcc aggtaggcat accagaacag 361 agctgccagg ttggcgaaga gcacccggaa cttcagaggg acgtagttga tgttgatgaa 421 ctgtagtggc gtccacaccc gccagttcat cctcagcgcc ggccagaagc cccccctcat 481 cttggcggcg aaggctgagg cgtctttccc ctccagaaag ttcatgatga ggaagaacaa 541 catgaggaag gccggtgcaa agacgaggcg gtccaggaga agcctcctga gccctgccag 601 ggggacctca ggagggatcc aatgttccat gaagaagtag aagaagtgac tcagcggccc 661 tgtgaagaag aacccgtaaa cggcatatct cagaggccca ccgacatcca gacttctaga 721 gttttctttt ttccgcttct tctcaatcat gctgggccag gaagttccca agtgctgaca 781 aaatgccact ggtggccgcc ttggtgagca ccgggtagag ccgcaggaag agcaagtact 841 gggcgagcgc ccgccgcggc agcgccccga gcccggcttc ggcccgcagc ctggacgcgg 901 ccggcgccat cgcctcccca gcgccgtgcc gccgggggca cctcgtgcc //