LOCUS BC008809 1346 bp mRNA linear HUM 11-DEC-2003
DEFINITION Homo sapiens angio-associated, migratory cell protein, mRNA (cDNA
clone IMAGE:3951873), partial cds.
ACCESSION BC008809
VERSION BC008809.2
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1346)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1346)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (25-MAY-2001) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT On Dec 9, 2003 this sequence version replaced BC008809.1.
Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: DCTD/DTP
cDNA Library Preparation: Rubin Laboratory
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: National Institutes of Health Intramural
Sequencing Center (NISC),
Gaithersburg, Maryland;
Web site: http://www.nisc.nih.gov/
Contact: nisc_mgc@nhgri.nih.gov
Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
Young,A., Zhang,L.-H. and Green,E.D.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 15 Row: j Column: 19.
FEATURES Location/Qualifiers
source 1..1346
/db_xref="H-InvDB:HIT000087158"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:3951873"
/tissue_type="Ovary, adenocarcinoma"
/clone_lib="NIH_MGC_9"
/lab_host="DH10B-R"
/note="Vector: pOTB7"
gene <1..1346
/gene="AAMP"
/db_xref="GeneID:14"
/db_xref="MIM:603488"
CDS <1..911
/gene="AAMP"
/codon_start=3
/product="AAMP protein"
/protein_id="AAH08809.2"
/db_xref="GeneID:14"
/db_xref="MIM:603488"
/translation="HKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGD
LEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGY
EDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTG
KVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQT
LRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFAL
SKDASLVVTTSGDHKAKVFCVQRPDR"
misc_feature 3..887
/gene="AAMP"
/note="WD40; Region: WD40 domain, found in a number of
eukaryotic proteins that cover a wide variety of functions
including adaptor/regulatory modules in signal
transduction, pre-mRNA processing and cytoskeleton
assembly"
/db_xref="CDD:cd00200"
BASE COUNT 294 a 343 c 411 g 298 t
ORIGIN
1 gccataaaga ctctgtgact tgtgctggtt tcagccatga ctccactcta gtggccacag
61 gggacatgag tggcctcttg aaagtgtggc aggtggacac taaggaggag gtctggtcct
121 ttgaagcggg agacctggag tggatggagt ggcatcctcg ggcacctgtc ctgttggcgg
181 gcacagctga cggcaacacc tggatgtgga aagtcccgaa tggtgactgc aagaccttcc
241 agggtcccaa ctgcccagcc acctgtggcc gagtcctccc tgatgggaag agagctgtgg
301 taggctatga agatgggacc atcaggattt gggacctgaa gcagggaagc cctatccatg
361 tactgaaagg gactgagggt caccagggcc cactcacctg tgttgctgcc aaccaggatg
421 gcagcttgat cctaactggc tctgtggact gccaggccaa gctggtcagt gccaccaccg
481 gcaaggtggt gggtgttttt agacctgaga ctgtggcctc ccagcccagc ctgggagaag
541 gggaggagag tgagtccaac tcggtggagt ccttgggctt ctgcagtgtg atgcccctgg
601 cagctgttgg ctacctggat gggaccttgg ccatctatga cctggctacg cagactctta
661 ggcatcagtg tcagcaccag tcgggcatcg tgcagctgct gtgggaggca ggcactgccg
721 tggtatatac ctgcagcctg gatggcatcg tgcgcctctg ggacgcccgg accggccgcc
781 tgcttactga ctaccggggc cacacggctg agatcctgga ctttgccctc agcaaagatg
841 cctccctggt ggtgaccacg tcaggagacc acaaagcgaa agtattttgt gtccaaaggc
901 ctgaccgtta atggctgcag cccctgcctg tgtgtctggt gttgagggga cgaagggacc
961 cctgcccctg tctgccagca gaggcagtag ggcacagagg gaagaggagg gtggggccct
1021 ggatgacttt ccagcctctt caactgactt gctcccctct ccttttcttc tctttagaga
1081 cccagcccag ggccctccca cccttgccca gacctggtgg gcccttcaga gggaggggtg
1141 gacctgtttc tctttcactt tcatttgctg gtgtgagcca tggggtgtgt atttgtatgt
1201 ggggagtagg tgtttgaggt tcccgttctt tcccttccca agtctctggg ggtggaaagg
1261 aggaagagat actagttaaa gattttaaaa atgtaaataa aatatacttc ccaaaaaaaa
1321 aaaaaaaaaa aaaaaaaaaa aaaaaa
//