LOCUS BC008390 1040 bp mRNA linear HUM 28-JUL-2005
DEFINITION Homo sapiens phosphodiesterase 4D, cAMP-specific (phosphodiesterase
E3 dunce homolog, Drosophila), mRNA (cDNA clone IMAGE:4280941),
complete cds.
ACCESSION BC008390
VERSION BC008390.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1040)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
CONSRTM Mammalian Gene Collection Program Team
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1040)
CONSRTM NIH MGC Project
TITLE Direct Submission
JOURNAL Submitted (25-MAY-2001) National Institutes of Health, Mammalian
Gene Collection (MGC), Bethesda, MD 20892-2590, USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: ATCC
cDNA Library Preparation: CLONTECH Laboratories, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 21 Row: d Column: 2
This clone has the following problem: The cds is short compared to
the longest cds in the locus.
FEATURES Location/Qualifiers
source 1..1040
/db_xref="H-InvDB:HIT000033760"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:4280941"
/tissue_type="Brain, primitive neuroectodermal"
/clone_lib="NIH_MGC_56"
/lab_host="DH10B"
/note="Vector: pDNR-LIB"
gene 1..1040
/gene="PDE4D"
/gene_synonym="HSPDE4D"
/gene_synonym="PDE4DN2"
/gene_synonym="STRK1"
/db_xref="GeneID:5144"
/db_xref="MIM:600129"
CDS 128..787
/gene="PDE4D"
/gene_synonym="HSPDE4D"
/gene_synonym="PDE4DN2"
/gene_synonym="STRK1"
/codon_start=1
/product="PDE4D protein"
/protein_id="AAH08390.1"
/db_xref="GeneID:5144"
/db_xref="MIM:600129"
/translation="MAQQTSPDTLTVPEVDNPHCPNPWLNEDLVKSLRENLLQHEKSK
TARKSVSPKLSPVISPRNSPRLLRRMLLSSNIPKQRRFTVAHTCFDVDNGTSAGRSPL
DPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVT
PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITGSWMELNPYTLLD
M"
BASE COUNT 317 a 259 c 219 g 245 t
ORIGIN
1 gaggcaggcg actgaatgca ctaacagcag caggctcaga cctgcttccc tggacatttc
61 cgggaccgtg agcgagggaa ccacgttgcc ctggattctt gccagctgta caaagttgac
121 caggaaaatg gctcagcaga caagcccgga cactttaaca gtacctgaag tggataatcc
181 gcattgtcca aacccgtggc tgaacgaaga ccttgtgaaa tccttgcgag aaaacctgtt
241 gcagcatgag aagtccaaga cagcgaggaa atcggtttct cccaagctct ctccagtgat
301 ctctccgaga aattccccca ggcttctgcg cagaatgctt ctcagcagca acatccccaa
361 acagcggcgt ttcacggtgg cacatacatg ttttgatgtg gacaatggca catctgcggg
421 acggagtccc ttggatccca tgaccagccc aggatccggg ctaattctcc aagcaaattt
481 tgtccacagt caacgacggg agtccttcct gtatcgatcc gacagcgatt atgacctctc
541 tccaaagtct atgtcccgga actcctccat tgccagtgat atacacggag atgacttgat
601 tgtgactcca tttgctcagg tcttggccag tctgcgaact gtacgaaaca actttgctgc
661 attaactaat ttgcaagatc gagcacctag caaaagatca cccatgtgca accaaccatc
721 catcaacaaa gccaccataa caggatcctg gatggaattg aacccatata cgttacttga
781 catgtgaaac acgtgtgacc ctggcagatg atttggctga ccttgaaaac tacagctgtt
841 tagtcacttt gaaaacaatg caatacaagt gatttactag gcttcagttt taaccatttt
901 atgctgactg gtggaaattc taacccttca gaaagaaaaa aaaattgtga agcaatggaa
961 atgtaccatc ctgggtatta atgtcattaa ttttcaatac attttctcgc aaaaaaaaaa
1021 aaaaaaaaaa aaaaaaaaaa
//