LOCUS       BC006324                 792 bp    mRNA    linear   HUM 12-NOV-2007
DEFINITION  Homo sapiens pterin-4 alpha-carbinolamine dehydratase/dimerization
            cofactor of hepatocyte nuclear factor 1 alpha, mRNA (cDNA clone
            MGC:12706 IMAGE:4138350), complete cds.
ACCESSION   BC006324
VERSION     BC006324.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 792)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 792)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Dec 9, 2003 this sequence version replaced BC006324.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 17 Row: k Column: 13
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 50086629.
FEATURES             Location/Qualifiers
     source          1..792
                     /db_xref="H-InvDB:HIT000032758"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:12706 IMAGE:4138350"
                     /tissue_type="Muscle, rhabdomyosarcoma"
                     /clone_lib="NIH_MGC_17"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..792
                     /gene="PCBD1"
                     /gene_synonym="PCD"
                     /gene_synonym="PHS"
                     /db_xref="GeneID:5092"
                     /db_xref="HGNC:HGNC:8646"
                     /db_xref="MIM:126090"
     CDS             19..333
                     /gene="PCBD1"
                     /gene_synonym="PCD"
                     /gene_synonym="PHS"
                     /codon_start=1
                     /product="pterin-4 alpha-carbinolamine
                     dehydratase/dimerization cofactor of hepatocyte nuclear
                     factor 1 alpha"
                     /protein_id="AAH06324.1"
                     /db_xref="GeneID:5092"
                     /db_xref="HGNC:HGNC:8646"
                     /db_xref="MIM:126090"
                     /translation="MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFN
                     RAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVS
                     MT"
BASE COUNT          207 a          218 c          184 g          183 t
ORIGIN      
        1 cctgctgccg cccgcgccat ggctggcaaa gcacacaggc tgagcgctga ggagagggac
       61 cagctgctgc caaacctgag ggctgtgggg tggaatgagc tggaaggccg tgatgccatc
      121 ttcaagcagt ttcatttcaa agacttcaac agggcctttg ggttcatgac aagagtggcc
      181 ctgcaggctg agaaactgga ccaccatcct gaatggttta acgtgtacaa caaggtccac
      241 atcacgctga gcacccatga gtgtgccggc ctttcagaac gggacataaa cctggccagc
      301 ttcatcgaac aagtagcagt gtccatgaca tagaccctgc ccttcctctt tgaattcttc
      361 cgggggaagg ggtgactgaa ctgggagtcc agggagggag ctgaggagcc cttaccctcc
      421 caccactccc ctcccaagac ccagccgccg ccgttgaggg ctgagtcctt gctgtgggat
      481 gtgccagtgt ccccaccaac accaggaatt tagacctttt ccctgcacca ctctcttcat
      541 cctgggggct ctgttacact aatttgaata aactctcccc tttctttgca acttcccagc
      601 aacaataatg attttcttgc caggccgtct cttgctccct aattcatttc ccaggaagct
      661 gtgatacagg gtgaaataaa gtcttgtctt agaaaccagg accctaaacc ccacactatg
      721 taatagaaac acatgtgttt ttatgtctca aataaaacta ttatatcact tggaaaaaaa
      781 aaaaaaaaaa aa
//