LOCUS BC006324 792 bp mRNA linear HUM 12-NOV-2007 DEFINITION Homo sapiens pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha, mRNA (cDNA clone MGC:12706 IMAGE:4138350), complete cds. ACCESSION BC006324 VERSION BC006324.2 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 792) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 792) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (09-APR-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT On Dec 9, 2003 this sequence version replaced BC006324.1. Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC cDNA Library Preparation: Rubin Laboratory cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: National Institutes of Health Intramural Sequencing Center (NISC), Gaithersburg, Maryland; Web site: http://www.nisc.nih.gov/ Contact: nisc_mgc@nhgri.nih.gov Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B., Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S., Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P., Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R., Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C., McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W., Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L., Young,A., Zhang,L.-H. and Green,E.D. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 17 Row: k Column: 13 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 50086629. FEATURES Location/Qualifiers source 1..792 /db_xref="H-InvDB:HIT000032758" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:12706 IMAGE:4138350" /tissue_type="Muscle, rhabdomyosarcoma" /clone_lib="NIH_MGC_17" /lab_host="DH10B-R" /note="Vector: pOTB7" gene 1..792 /gene="PCBD1" /gene_synonym="PCD" /gene_synonym="PHS" /db_xref="GeneID:5092" /db_xref="HGNC:HGNC:8646" /db_xref="MIM:126090" CDS 19..333 /gene="PCBD1" /gene_synonym="PCD" /gene_synonym="PHS" /codon_start=1 /product="pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha" /protein_id="AAH06324.1" /db_xref="GeneID:5092" /db_xref="HGNC:HGNC:8646" /db_xref="MIM:126090" /translation="MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFN RAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVS MT" BASE COUNT 207 a 218 c 184 g 183 t ORIGIN 1 cctgctgccg cccgcgccat ggctggcaaa gcacacaggc tgagcgctga ggagagggac 61 cagctgctgc caaacctgag ggctgtgggg tggaatgagc tggaaggccg tgatgccatc 121 ttcaagcagt ttcatttcaa agacttcaac agggcctttg ggttcatgac aagagtggcc 181 ctgcaggctg agaaactgga ccaccatcct gaatggttta acgtgtacaa caaggtccac 241 atcacgctga gcacccatga gtgtgccggc ctttcagaac gggacataaa cctggccagc 301 ttcatcgaac aagtagcagt gtccatgaca tagaccctgc ccttcctctt tgaattcttc 361 cgggggaagg ggtgactgaa ctgggagtcc agggagggag ctgaggagcc cttaccctcc 421 caccactccc ctcccaagac ccagccgccg ccgttgaggg ctgagtcctt gctgtgggat 481 gtgccagtgt ccccaccaac accaggaatt tagacctttt ccctgcacca ctctcttcat 541 cctgggggct ctgttacact aatttgaata aactctcccc tttctttgca acttcccagc 601 aacaataatg attttcttgc caggccgtct cttgctccct aattcatttc ccaggaagct 661 gtgatacagg gtgaaataaa gtcttgtctt agaaaccagg accctaaacc ccacactatg 721 taatagaaac acatgtgttt ttatgtctca aataaaacta ttatatcact tggaaaaaaa 781 aaaaaaaaaa aa //