LOCUS BC004500 837 bp mRNA linear HUM 02-MAR-2004 DEFINITION Homo sapiens chromosome 9 open reading frame 89, mRNA (cDNA clone MGC:11115 IMAGE:3833318), complete cds. ACCESSION BC004500 VERSION BC004500.2 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 837) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 837) AUTHORS Strausberg,R. TITLE Direct Submission JOURNAL Submitted (12-MAR-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Cancer Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT On Aug 19, 2003 this sequence version replaced BC004500.1. Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC/DCTD/DTP cDNA Library Preparation: Rubin Laboratory cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Institute for Systems Biology http://www.systemsbiology.org contact: amadan@systemsbiology.org Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 14 Row: b Column: 15 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 21362043. FEATURES Location/Qualifiers source 1..837 /db_xref="H-InvDB:HIT000031991" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:11115 IMAGE:3833318" /tissue_type="Skin, melanotic melanoma." /clone_lib="NIH_MGC_20" /lab_host="DH10B-R" /note="Vector: pOTB7" gene 1..837 /gene="C9orf89" /gene_synonym="bA370F5.1" /gene_synonym="MGC11115" /db_xref="GeneID:84270" CDS 93..644 /gene="C9orf89" /gene_synonym="bA370F5.1" /gene_synonym="MGC11115" /codon_start=1 /product="C9orf89 protein" /protein_id="AAH04500.1" /db_xref="GeneID:84270" /translation="MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILT NKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQ NSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFS PVIIDRHVSRYLLAFLADDLGGL" BASE COUNT 178 a 259 c 235 g 165 t ORIGIN 1 gagcacggcc cgcgggcggc gttcgctgga gctggtggac cgggcggcgg ggcagaccgc 61 tggggactgc gggcggcgct gtgtccgtcg ccatgacaga tcagacctat tgtgaccgcc 121 tggtgcagga cacgcctttc ctgacaggcc atgggcgctt gagtgagcag caggtggaca 181 ggatcatcct ccagctgaac cgttactacc cacagatcct taccaacaag gaggcggaaa 241 agttccggaa ccccaaggca tccttgcgtg tgcggctttg tgacctcctg agccacctgc 301 agcggagcgg tgagcgggac tgccaggagt tctaccgagc cctgtatatc catgcccagc 361 ccctgcacag ccgcctgccc agccgccacg ctctgcagaa ctcagattgc acagagctag 421 actcgggcag ccagagcggc gagctgagta acaggggacc catgagcttc ctggctggcc 481 tgggccttgc tgtgggactg gccctgctcc tgtactgcta tccgccagac cccaagggcc 541 tgccagggac ccggcgcgtc ctcggtttct cgcctgtcat catcgacaga catgtcagcc 601 gctacctgct ggccttcctg gcagatgacc taggggggct ctgacagacc ctggacccag 661 ggcctcacct gccactcaac caaagagtcc tcgagccggc ctgccaaggg gactgctgct 721 tctttttcta aatgcatatt tttcattatt tataatttgt gtaaaaaaca caccttcacc 781 ttacaaggtg ctgaccatat taaatgttca agttctctca aaaaaaaaaa aaaaaaa //