LOCUS       BC004500                 837 bp    mRNA    linear   HUM 02-MAR-2004
DEFINITION  Homo sapiens chromosome 9 open reading frame 89, mRNA (cDNA clone
            MGC:11115 IMAGE:3833318), complete cds.
ACCESSION   BC004500
VERSION     BC004500.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 837)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 837)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-MAR-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC004500.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 14 Row: b Column: 15
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 21362043.
FEATURES             Location/Qualifiers
     source          1..837
                     /db_xref="H-InvDB:HIT000031991"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:11115 IMAGE:3833318"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_20"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..837
                     /gene="C9orf89"
                     /gene_synonym="bA370F5.1"
                     /gene_synonym="MGC11115"
                     /db_xref="GeneID:84270"
     CDS             93..644
                     /gene="C9orf89"
                     /gene_synonym="bA370F5.1"
                     /gene_synonym="MGC11115"
                     /codon_start=1
                     /product="C9orf89 protein"
                     /protein_id="AAH04500.1"
                     /db_xref="GeneID:84270"
                     /translation="MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILT
                     NKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQ
                     NSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFS
                     PVIIDRHVSRYLLAFLADDLGGL"
BASE COUNT          178 a          259 c          235 g          165 t
ORIGIN      
        1 gagcacggcc cgcgggcggc gttcgctgga gctggtggac cgggcggcgg ggcagaccgc
       61 tggggactgc gggcggcgct gtgtccgtcg ccatgacaga tcagacctat tgtgaccgcc
      121 tggtgcagga cacgcctttc ctgacaggcc atgggcgctt gagtgagcag caggtggaca
      181 ggatcatcct ccagctgaac cgttactacc cacagatcct taccaacaag gaggcggaaa
      241 agttccggaa ccccaaggca tccttgcgtg tgcggctttg tgacctcctg agccacctgc
      301 agcggagcgg tgagcgggac tgccaggagt tctaccgagc cctgtatatc catgcccagc
      361 ccctgcacag ccgcctgccc agccgccacg ctctgcagaa ctcagattgc acagagctag
      421 actcgggcag ccagagcggc gagctgagta acaggggacc catgagcttc ctggctggcc
      481 tgggccttgc tgtgggactg gccctgctcc tgtactgcta tccgccagac cccaagggcc
      541 tgccagggac ccggcgcgtc ctcggtttct cgcctgtcat catcgacaga catgtcagcc
      601 gctacctgct ggccttcctg gcagatgacc taggggggct ctgacagacc ctggacccag
      661 ggcctcacct gccactcaac caaagagtcc tcgagccggc ctgccaaggg gactgctgct
      721 tctttttcta aatgcatatt tttcattatt tataatttgt gtaaaaaaca caccttcacc
      781 ttacaaggtg ctgaccatat taaatgttca agttctctca aaaaaaaaaa aaaaaaa
//