LOCUS BC004487 559 bp mRNA linear HUM 19-MAR-2009 DEFINITION Homo sapiens hypothetical LOC644903, mRNA (cDNA clone MGC:10701 IMAGE:3832541), complete cds. ACCESSION BC004487 VERSION BC004487.2 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 559) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 559) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (12-MAR-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT On Aug 19, 2003 this sequence version replaced BC004487.1. Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC/DCTD/DTP cDNA Library Preparation: Rubin Laboratory cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Institute for Systems Biology http://www.systemsbiology.org contact: amadan@systemsbiology.org Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 14 Row: l Column: 11 This clone was selected for full length sequencing because it passed the following selection criteria: GenomeScan gene prediction The stop codon of the CDS annotated on this record is located > 55 bases upstream of a splice junction, and therefore the mRNA is predicted to be subject to nonsense-mediated mRNA decay (NMD). FEATURES Location/Qualifiers source 1..559 /db_xref="H-InvDB:HIT000031983" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:10701 IMAGE:3832541" /tissue_type="Skin, melanotic melanoma." /clone_lib="NIH_MGC_20" /lab_host="DH10B-R" /note="Vector: pOTB7" gene 1..559 /gene="FLJ38668" /db_xref="GeneID:644903" CDS 100..252 /gene="FLJ38668" /codon_start=1 /product="FLJ38668 protein" /protein_id="AAH04487.1" /db_xref="GeneID:644903" /translation="MAVTGAGSGARLSLPRGSSDSTRVAARPWQRPSSRGWELHRVPP RPGEDA" BASE COUNT 125 a 143 c 190 g 101 t ORIGIN 1 gggaggctgg cgcaaacgca gcgggtggct ggggtagggg ctcattggga gcccacggag 61 cgcggcggcg gctcgggggc cgagttccct acaacaagga tggcggtgac gggcgcaggg 121 agcggggccc ggctctcctt gcctcgaggc tcctctgatt ccactcgcgt ggctgcgcgg 181 ccctggcagc ggccttcgtc ccgggggtgg gagctacaca gggttccgcc ccgtcctggc 241 gaggacgcct gagggggctc tgtggtaagg ctctgtcggg caggccgggc ttccgggagg 301 acctggtctg gatcggtcac cgctgggtgc ctgagctccg catggagcct gcagcctttg 361 tttaacttat aaagaaatgg gggctccgag cagtcaagaa gaacatgccc caagttattc 421 gtcagtgagg cggaaattgt ggtgtacttg ttccagacca actatgaaga taggatgccc 481 atccagaaga acgggaagca ttttcttcct cacctttgga aagtaaaaca aaaaaaaaaa 541 gaaaaaaaaa aaaaaaaaa //