LOCUS       BC004487                 559 bp    mRNA    linear   HUM 19-MAR-2009
DEFINITION  Homo sapiens hypothetical LOC644903, mRNA (cDNA clone MGC:10701
            IMAGE:3832541), complete cds.
ACCESSION   BC004487
VERSION     BC004487.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 559)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 559)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-MAR-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC004487.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 14 Row: l Column: 11
            This clone was selected for full length sequencing because it
            passed the following selection criteria: GenomeScan gene prediction
            The stop codon of the CDS annotated on this record is located > 55
            bases upstream of a splice junction, and therefore the mRNA is
            predicted to be subject to nonsense-mediated mRNA decay (NMD).
FEATURES             Location/Qualifiers
     source          1..559
                     /db_xref="H-InvDB:HIT000031983"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:10701 IMAGE:3832541"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_20"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..559
                     /gene="FLJ38668"
                     /db_xref="GeneID:644903"
     CDS             100..252
                     /gene="FLJ38668"
                     /codon_start=1
                     /product="FLJ38668 protein"
                     /protein_id="AAH04487.1"
                     /db_xref="GeneID:644903"
                     /translation="MAVTGAGSGARLSLPRGSSDSTRVAARPWQRPSSRGWELHRVPP
                     RPGEDA"
BASE COUNT          125 a          143 c          190 g          101 t
ORIGIN      
        1 gggaggctgg cgcaaacgca gcgggtggct ggggtagggg ctcattggga gcccacggag
       61 cgcggcggcg gctcgggggc cgagttccct acaacaagga tggcggtgac gggcgcaggg
      121 agcggggccc ggctctcctt gcctcgaggc tcctctgatt ccactcgcgt ggctgcgcgg
      181 ccctggcagc ggccttcgtc ccgggggtgg gagctacaca gggttccgcc ccgtcctggc
      241 gaggacgcct gagggggctc tgtggtaagg ctctgtcggg caggccgggc ttccgggagg
      301 acctggtctg gatcggtcac cgctgggtgc ctgagctccg catggagcct gcagcctttg
      361 tttaacttat aaagaaatgg gggctccgag cagtcaagaa gaacatgccc caagttattc
      421 gtcagtgagg cggaaattgt ggtgtacttg ttccagacca actatgaaga taggatgccc
      481 atccagaaga acgggaagca ttttcttcct cacctttgga aagtaaaaca aaaaaaaaaa
      541 gaaaaaaaaa aaaaaaaaa
//