LOCUS BC004125 2265 bp mRNA linear HUM 11-DEC-2003
DEFINITION Homo sapiens zinc finger protein 500, mRNA (cDNA clone
IMAGE:3937229), partial cds.
ACCESSION BC004125
VERSION BC004125.2
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2265)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 2265)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (01-MAR-2001) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT On Aug 19, 2003 this sequence version replaced BC004125.1.
Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: DCTD/DTP
cDNA Library Preparation: Rubin Laboratory
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Institute for Systems Biology
http://www.systemsbiology.org
contact: amadan@systemsbiology.org
Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 14 Row: h Column: 16
This clone was selected for full length sequencing because it
passed the following selection criteria: Hexamer frequency ORF
analysis.
FEATURES Location/Qualifiers
source 1..2265
/db_xref="H-InvDB:HIT000086293"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:3937229"
/tissue_type="Lung, small cell carcinoma"
/clone_lib="NIH_MGC_7"
/lab_host="DH10B-R"
/note="Vector: pOTB7"
gene <1..2265
/gene="ZNF500"
/gene_synonym="KIAA0557"
/db_xref="GeneID:26048"
CDS <1..684
/gene="ZNF500"
/gene_synonym="KIAA0557"
/codon_start=1
/product="ZNF500 protein"
/protein_id="AAH04125.2"
/db_xref="GeneID:26048"
/translation="GPGIQLEDGGDGREDAPLRMEWYRVLSARCQGPGHPLPGQRPAP
VRGLVRPDQPRGGPPPGRRASHGADKPYTCPECGKGFSKTSHLTKHQRTHTGERPYKC
LVCGKGFSDRSNFSTHQRVHTGEKPYPCPECGKRFSQSSSLVIHRRTHSGERPYACTQ
CGKRFNNSSHFSAHRRTHTGEKPYTCPACGRGFRRGTDLHKHQRTHMGAGSLPTLQPV
APGGPGAKA"
misc_feature 214..282
/gene="ZNF500"
/gene_synonym="KIAA0557"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
misc_feature 382..450
/gene="ZNF500"
/gene_synonym="KIAA0557"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
BASE COUNT 457 a 702 c 640 g 466 t
ORIGIN
1 ggacctggga tccagttgga ggacggcggt gatggcaggg aggatgcccc gttgagaatg
61 gagtggtacc gagtgctctc ggcacgatgc caggggcctg gccacccgct cccaggtcag
121 aggccagccc cagtcagggg cttggtcagg cctgatcagc caagaggcgg ccccccacca
181 ggaagacggg cttcccatgg ggctgacaag ccgtacacct gccccgaatg tggcaaaggc
241 ttcagcaaga cgtcccactt gaccaagcac cagcgcacac acacgggcga gcggccttac
301 aagtgcctag tctgtgggaa gggctttagc gaccgctcca acttcagcac gcaccagagg
361 gtgcacacag gcgagaagcc ctacccgtgc cccgagtgtg ggaagcgctt cagccagagc
421 tccagcctgg tcatccaccg caggacacac agcggggagc ggccctatgc ctgcacccag
481 tgcgggaagc gcttcaacaa cagctcgcac ttcagcgccc accgccggac gcacacaggt
541 gagaagccct acacctgccc ggcctgtggc cggggcttcc gccggggcac cgacctgcac
601 aagcaccagc ggacccacat gggggcaggc tccttgccga cgctccagcc ggtggctcct
661 ggaggccccg gtgcaaaagc ctgatcacca tgcctgaaac tccctttcca ggactctcat
721 ccctgggcac agaattcagg aaactgctag acagcctggt ccgaaagcat tgccagctgc
781 ccgtttcctc ccatggccca gtatgaggcc agcaggggac atttgggatg cccaggccgc
841 agaggaagct gggcactggg tgcagaacaa gggcaaggac aggctctgag tgtccagtgg
901 cagccagaac aggtgacaca gagcaggggc ttcagccaca gagacacact caggaggcca
961 gaagccgaca ctcaaggtgt tcgtggggct ggctcctgaa gggcctggga gggtccatca
1021 gctgcctcca gcatccagtg gctgctggca tacagcctca tccccacgtc ccaacccctc
1081 tcctgtgtgt ctgtgaccct gtgcgctgtc tctgtgtgta ccccccacct gctccccccc
1141 cctttttttt ttgagacggg gccttgctgt gtcccccagg cgggaataca gtgccatgat
1201 catagctcac tgcagccttg aatccctggg ctcaagtgtt cctcctgcct catcctcctg
1261 agtagctggg gttacaggtg tgtgccgcca tgcccagtct cttttttggt agggccacca
1321 ctcactgggt ttagggttcc ccaatacact gtgacctcat cttaactaat tatatcatca
1381 aaacccgtgt ttccaaataa ggtcacattc tgaggtctgg gtgcacatga atttgaggga
1441 cccctcgtct gctgcaggga gccctgctgt accccagcct tcccaggacg tggtctccag
1501 cttcttcatc ctgccagagt ttccaaatgg agcccggggc tctgcagcat tccagtcccc
1561 tttgcagatc catagctgct ctgcagggcg gaagacacct ggggcgggaa agcacccctg
1621 agttccatct tcctgacatg tcgcctggga tgtgacgggc ctgacatctc cccagggccg
1681 gggcccaggg ctgcctttgc tcctggcccc ttagtgtctg gaatgtggcc ttccacggtt
1741 gccccacttt gtctttctaa ggtaagaagc cttcaccttc cagcttttgt ctggcctgtg
1801 ctgcgtggga gccactggtc tgtgcacatc cacggtgggt gagtggccaa gacaagcagt
1861 gtgatagagt ccttggtggg tttagtcatc tcggaagtcg tagggcagct atggaaacca
1921 ctgggttctg gaacgttcca gccaggcagt ggttgttcct cataggtagg tggccttggc
1981 cttcatccca gcctgggatg ctccattgca tttgtcacct agtcactgta tatacgtgca
2041 catttgacct tttggcacag cccaggttcc aggtgcgtga cctgcccttt ttctcattcc
2101 cttaactgac attatttagt gtcagaggcc gagcacagtg gctcccacct ataatcctag
2161 cactttggga ggccaacgcg ggtggattgc ttgagcccag gagttcaaga gcagcctggg
2221 caatatagaa agacctcttc cctaccaaaa aaaaaaaaaa aaaaa
//