LOCUS       AY971142                 408 bp    mRNA    linear   HUM 21-DEC-2015
DEFINITION  Homo sapiens clone 131 immunoglobulin alpha heavy chain variable
            region mRNA, partial cds.
ACCESSION   AY971142
VERSION     AY971142.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 408)
  AUTHORS   Coker,H.A., Harries,H.E., Banfield,G.K., Carr,V.A., Durham,S.R.,
            Chevretton,E., Hobby,P., Sutton,B.J. and Gould,H.J.
  TITLE     Biased use of VH5 IgE-positive B cells in the nasal mucosa in
            allergic rhinitis
  JOURNAL   J. Allergy Clin. Immunol. 116 (2), 445-452 (2005)
   PUBMED   16083804
REFERENCE   2  (bases 1 to 408)
  AUTHORS   Coker,H.A., Harries,H.E., Banfield,G.K., Carr,V.A., Durham,S.R.,
            Chevretton,E., Hobby,P., Sutton,B.J. and Gould,H.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-MAR-2005) Randall Division of Cell and Molecular
            Biophysics, King's College London, St. Thomas Street, London SE1
            1UL, UK
FEATURES             Location/Qualifiers
     source          1..408
                     /db_xref="H-InvDB:HIT000333539_04"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolation_source="nasal mucosa of allergic rhinitis
                     patient"
                     /db_xref="taxon:9606"
                     /clone="131"
     CDS             <1..>408
                     /codon_start=1
                     /product="immunoglobulin alpha heavy chain variable
                     region"
                     /protein_id="AAY18563.1"
                     /translation="EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKG
                     LEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTTGG
                     DYGGLDAFDIWGQGTMVTVSSASPTSPKVFPLSL"
BASE COUNT           97 a          104 c          122 g           85 t
ORIGIN      
        1 gaggtgcagc tggtggagtc tgggggaggc ttggtaaagc ctggggggtc ccttagactc
       61 tcctgtgcag cctctggatt cactttcagt aacgcctgga tgagctgggt ccgccaggct
      121 ccagggaagg ggctggagtg ggttggccgt attaaaagca aaactgatgg tgggacaaca
      181 gactacgctg cacccgtgaa aggcagattc accatctcaa gagatgattc aaaaaacacg
      241 ctgtatctgc aaatgaacag cctgaaaacc gaggacacag ccgtgtatta ctgtaccaca
      301 gggggcgact acggtggact tgatgctttt gatatctggg gccaagggac aatggtcacc
      361 gtctcttcag catccccgac cagccccaag gtcttcccgc tgagcctc
//