LOCUS AY971142 408 bp mRNA linear HUM 21-DEC-2015 DEFINITION Homo sapiens clone 131 immunoglobulin alpha heavy chain variable region mRNA, partial cds. ACCESSION AY971142 VERSION AY971142.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 408) AUTHORS Coker,H.A., Harries,H.E., Banfield,G.K., Carr,V.A., Durham,S.R., Chevretton,E., Hobby,P., Sutton,B.J. and Gould,H.J. TITLE Biased use of VH5 IgE-positive B cells in the nasal mucosa in allergic rhinitis JOURNAL J. Allergy Clin. Immunol. 116 (2), 445-452 (2005) PUBMED 16083804 REFERENCE 2 (bases 1 to 408) AUTHORS Coker,H.A., Harries,H.E., Banfield,G.K., Carr,V.A., Durham,S.R., Chevretton,E., Hobby,P., Sutton,B.J. and Gould,H.J. TITLE Direct Submission JOURNAL Submitted (22-MAR-2005) Randall Division of Cell and Molecular Biophysics, King's College London, St. Thomas Street, London SE1 1UL, UK FEATURES Location/Qualifiers source 1..408 /db_xref="H-InvDB:HIT000333539_04" /organism="Homo sapiens" /mol_type="mRNA" /isolation_source="nasal mucosa of allergic rhinitis patient" /db_xref="taxon:9606" /clone="131" CDS <1..>408 /codon_start=1 /product="immunoglobulin alpha heavy chain variable region" /protein_id="AAY18563.1" /translation="EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKG LEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTTGG DYGGLDAFDIWGQGTMVTVSSASPTSPKVFPLSL" BASE COUNT 97 a 104 c 122 g 85 t ORIGIN 1 gaggtgcagc tggtggagtc tgggggaggc ttggtaaagc ctggggggtc ccttagactc 61 tcctgtgcag cctctggatt cactttcagt aacgcctgga tgagctgggt ccgccaggct 121 ccagggaagg ggctggagtg ggttggccgt attaaaagca aaactgatgg tgggacaaca 181 gactacgctg cacccgtgaa aggcagattc accatctcaa gagatgattc aaaaaacacg 241 ctgtatctgc aaatgaacag cctgaaaacc gaggacacag ccgtgtatta ctgtaccaca 301 gggggcgact acggtggact tgatgctttt gatatctggg gccaagggac aatggtcacc 361 gtctcttcag catccccgac cagccccaag gtcttcccgc tgagcctc //