LOCUS       AY751850                 150 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens isolate 971.2_C001 T cell receptor beta (TRBV) mRNA,
            partial cds.
ACCESSION   AY751850
VERSION     AY751850.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 150)
  AUTHORS   Biegler,B.W., Yan,S.X., Ortega,S.B., Tennakoon,D.K., Racke,M.K. and
            Karandikar,N.J.
  TITLE     Glatiramer acetate (GA) therapy induces a focused, oligoclonal CD8+
            T-cell repertoire in multiple sclerosis
  JOURNAL   J. Neuroimmunol. 180 (1-2), 159-171 (2006)
   PUBMED   16935352
REFERENCE   2  (bases 1 to 150)
  AUTHORS   Biegler,B.W., Yan,S.X., Ortega,S.B., Tennakoon,D.K., Racke,M.K. and
            Karandikar,N.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2004) Pathology, The University of Texas
            Southwestern Medical Center, 5323 Harry Hines Blvd., Dallas, TX
            75390-9072, USA
FEATURES             Location/Qualifiers
     source          1..150
                     /db_xref="H-InvDB:HIT000257521"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="971.2_C001"
                     /db_xref="taxon:9606"
                     /cell_type="CD4 T cells stimulated with copaxone"
     gene            <1..>150
                     /gene="TRBV"
     CDS             <1..>150
                     /gene="TRBV"
                     /note="TCR; CD4 T cells stimulated with copaxone"
                     /codon_start=1
                     /product="T cell receptor beta"
                     /protein_id="AAV32386.1"
                     /translation="FSNSRSEMNVSTLELGDSALYLCASSFRQTYNEQFFGPGTRLTV
                     LEDLKN"
BASE COUNT           32 a           43 c           41 g           34 t
ORIGIN      
        1 ttctctaact ctcgctctga gatgaatgtg agcaccttgg agctggggga ctcggccctt
       61 tatctttgcg ccagcagctt ccggcagacc tacaatgagc agttcttcgg gccagggaca
      121 cggctcaccg tgctagagga cctgaaaaac
//