LOCUS AY751850 150 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens isolate 971.2_C001 T cell receptor beta (TRBV) mRNA, partial cds. ACCESSION AY751850 VERSION AY751850.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 150) AUTHORS Biegler,B.W., Yan,S.X., Ortega,S.B., Tennakoon,D.K., Racke,M.K. and Karandikar,N.J. TITLE Glatiramer acetate (GA) therapy induces a focused, oligoclonal CD8+ T-cell repertoire in multiple sclerosis JOURNAL J. Neuroimmunol. 180 (1-2), 159-171 (2006) PUBMED 16935352 REFERENCE 2 (bases 1 to 150) AUTHORS Biegler,B.W., Yan,S.X., Ortega,S.B., Tennakoon,D.K., Racke,M.K. and Karandikar,N.J. TITLE Direct Submission JOURNAL Submitted (15-SEP-2004) Pathology, The University of Texas Southwestern Medical Center, 5323 Harry Hines Blvd., Dallas, TX 75390-9072, USA FEATURES Location/Qualifiers source 1..150 /db_xref="H-InvDB:HIT000257521" /organism="Homo sapiens" /mol_type="mRNA" /isolate="971.2_C001" /db_xref="taxon:9606" /cell_type="CD4 T cells stimulated with copaxone" gene <1..>150 /gene="TRBV" CDS <1..>150 /gene="TRBV" /note="TCR; CD4 T cells stimulated with copaxone" /codon_start=1 /product="T cell receptor beta" /protein_id="AAV32386.1" /translation="FSNSRSEMNVSTLELGDSALYLCASSFRQTYNEQFFGPGTRLTV LEDLKN" BASE COUNT 32 a 43 c 41 g 34 t ORIGIN 1 ttctctaact ctcgctctga gatgaatgtg agcaccttgg agctggggga ctcggccctt 61 tatctttgcg ccagcagctt ccggcagacc tacaatgagc agttcttcgg gccagggaca 121 cggctcaccg tgctagagga cctgaaaaac //