LOCUS AY749165 339 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens clone 010.3B11 immunoglobulin light chain variable region mRNA, partial cds. ACCESSION AY749165 VERSION AY749165.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 339) AUTHORS Reason,D.C. and Zhou,J. TITLE Codon insertion and deletion functions as a somatic diversification mechanism in human antibody repertoires JOURNAL Unpublished REFERENCE 2 (bases 1 to 339) AUTHORS Reason,D.C. and Zhou,J. TITLE Direct Submission JOURNAL Submitted (14-SEP-2004) Research Institute, Children's Hospital Oakland, 5700 MLK Jr. Way, Oakland, CA 94609, USA FEATURES Location/Qualifiers source 1..339 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="010.3B11" CDS <1..>339 /codon_start=1 /product="immunoglobulin light chain variable region" /protein_id="AAV31079.1" /translation="ELTQSPDSLAVSLGERATINCKSSQTVLYSSNIKNFLAWYQQKP GQPPKLLIYWASTRESGVPDRFSGSGSGTNFTLTISSLQPEDVAVYYCQQYYDTPPVT FGQGTKVEIKR" BASE COUNT 83 a 97 c 83 g 76 t ORIGIN 1 gagctcactc agtctccaga ctccctggct gtgtctctgg gcgagagggc caccatcaac 61 tgcaagtcca gccagactgt tttatacagc tccaacatta agaacttctt agcttggtac 121 cagcagaaac cagggcagcc tcctaagttg ctcatttact gggcatctac ccgggaatcc 181 ggggtccctg accgattcag tggcagcggg tctgggacaa atttcactct caccatcagc 241 agcctgcagc ctgaagatgt ggcagtttat tactgtcagc aatattatga cactcccccg 301 gtgacgttcg gccaagggac caaggtggaa atcaaacga //