LOCUS       AY749165                 339 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens clone 010.3B11 immunoglobulin light chain variable
            region mRNA, partial cds.
ACCESSION   AY749165
VERSION     AY749165.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 339)
  AUTHORS   Reason,D.C. and Zhou,J.
  TITLE     Codon insertion and deletion functions as a somatic diversification
            mechanism in human antibody repertoires
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 339)
  AUTHORS   Reason,D.C. and Zhou,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-SEP-2004) Research Institute, Children's Hospital
            Oakland, 5700 MLK Jr. Way, Oakland, CA 94609, USA
FEATURES             Location/Qualifiers
     source          1..339
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="010.3B11"
     CDS             <1..>339
                     /codon_start=1
                     /product="immunoglobulin light chain variable region"
                     /protein_id="AAV31079.1"
                     /translation="ELTQSPDSLAVSLGERATINCKSSQTVLYSSNIKNFLAWYQQKP
                     GQPPKLLIYWASTRESGVPDRFSGSGSGTNFTLTISSLQPEDVAVYYCQQYYDTPPVT
                     FGQGTKVEIKR"
BASE COUNT           83 a           97 c           83 g           76 t
ORIGIN      
        1 gagctcactc agtctccaga ctccctggct gtgtctctgg gcgagagggc caccatcaac
       61 tgcaagtcca gccagactgt tttatacagc tccaacatta agaacttctt agcttggtac
      121 cagcagaaac cagggcagcc tcctaagttg ctcatttact gggcatctac ccgggaatcc
      181 ggggtccctg accgattcag tggcagcggg tctgggacaa atttcactct caccatcagc
      241 agcctgcagc ctgaagatgt ggcagtttat tactgtcagc aatattatga cactcccccg
      301 gtgacgttcg gccaagggac caaggtggaa atcaaacga
//