LOCUS AY570298 345 bp mRNA linear HUM 18-OCT-2004 DEFINITION Homo sapiens hepatocellular carcinoma-downregulated mitochondrial carrier protein mRNA, complete cds, alternatively spliced; nuclear gene for mitochondrial product. ACCESSION AY570298 VERSION AY570298.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 345) AUTHORS Tan,M.G., Ooi,L.L., Aw,S.E. and Hui,K.M. TITLE Cloning and identification of hepatocellular carcinoma down-regulated mitochondrial carrier protein, a novel liver-specific uncoupling protein JOURNAL J. Biol. Chem. 279 (43), 45235-45244 (2004) PUBMED 15322095 REFERENCE 2 (bases 1 to 345) AUTHORS Tan,M.G.K., Aw,S.E. and Hui,K.M. TITLE Direct Submission JOURNAL Submitted (10-MAR-2004) Clinical Research, Singapore General Hospital, Outram Road, Singapore 169608, Singapore FEATURES Location/Qualifiers source 1..345 /db_xref="H-InvDB:HIT000255546" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.31" 5'UTR 1..73 CDS 74..166 /note="HDCMP; alternatively spliced" /codon_start=1 /product="hepatocellular carcinoma-downregulated mitochondrial carrier protein" /protein_id="AAS77211.1" /translation="MDFVAGAIGGVCGVAVGYPLDTVKGLLALP" 3'UTR 167..345 BASE COUNT 51 a 113 c 108 g 73 t ORIGIN 1 gttgaggcca ccctggtggc accaaagccc tctcaggcag gcagacccag ggcctccccg 61 ccacaccttg ttcatggatt ttgtcgctgg agccatcgga ggcgtctgcg gtgttgctgt 121 gggctacccc ctggacacgg tgaagggcct gctggccttg ccctaggcct ggagccgctc 181 gtgcctgaag cccacttctc ctgcaggtca ggatccagac ggagccaaag tacacaggca 241 tctggcactg cgtccgggat acgtatcacc gagagcgcgt gtggggcttc taccggggcc 301 tctcgctgcc cgtgtgcacg gtgtccctgg tatcttccgt gtctt //