LOCUS       AY570298                 345 bp    mRNA    linear   HUM 18-OCT-2004
DEFINITION  Homo sapiens hepatocellular carcinoma-downregulated mitochondrial
            carrier protein mRNA, complete cds, alternatively spliced; nuclear
            gene for mitochondrial product.
ACCESSION   AY570298
VERSION     AY570298.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 345)
  AUTHORS   Tan,M.G., Ooi,L.L., Aw,S.E. and Hui,K.M.
  TITLE     Cloning and identification of hepatocellular carcinoma
            down-regulated mitochondrial carrier protein, a novel
            liver-specific uncoupling protein
  JOURNAL   J. Biol. Chem. 279 (43), 45235-45244 (2004)
   PUBMED   15322095
REFERENCE   2  (bases 1 to 345)
  AUTHORS   Tan,M.G.K., Aw,S.E. and Hui,K.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-MAR-2004) Clinical Research, Singapore General
            Hospital, Outram Road, Singapore 169608, Singapore
FEATURES             Location/Qualifiers
     source          1..345
                     /db_xref="H-InvDB:HIT000255546"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="14"
                     /map="14q32.31"
     5'UTR           1..73
     CDS             74..166
                     /note="HDCMP; alternatively spliced"
                     /codon_start=1
                     /product="hepatocellular carcinoma-downregulated
                     mitochondrial carrier protein"
                     /protein_id="AAS77211.1"
                     /translation="MDFVAGAIGGVCGVAVGYPLDTVKGLLALP"
     3'UTR           167..345
BASE COUNT           51 a          113 c          108 g           73 t
ORIGIN      
        1 gttgaggcca ccctggtggc accaaagccc tctcaggcag gcagacccag ggcctccccg
       61 ccacaccttg ttcatggatt ttgtcgctgg agccatcgga ggcgtctgcg gtgttgctgt
      121 gggctacccc ctggacacgg tgaagggcct gctggccttg ccctaggcct ggagccgctc
      181 gtgcctgaag cccacttctc ctgcaggtca ggatccagac ggagccaaag tacacaggca
      241 tctggcactg cgtccgggat acgtatcacc gagagcgcgt gtggggcttc taccggggcc
      301 tctcgctgcc cgtgtgcacg gtgtccctgg tatcttccgt gtctt
//