LOCUS       AY533031                 378 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens mitochondrial glycine cleavage system H-protein
            precursor mRNA, partial cds; nuclear gene for mitochondrial
            product.
ACCESSION   AY533031
VERSION     AY533031.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 378)
  AUTHORS   Choy,F.Y.M. and Sinclair,G.
  TITLE     Nucleotide sequence of the mature hydrogen carrier protein in
            glycine cleavage enzyme complex from human cultured skin
            fibroblasts
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 378)
  AUTHORS   Choy,F.Y.M. and Sinclair,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JAN-2004) Biology, University of Victoria, P.O. Box
            3020, Station CSC, Victoria, BC V8W 3N5, Canada
FEATURES             Location/Qualifiers
     source          1..378
                     /db_xref="H-InvDB:HIT000255201"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="16"
                     /map="16q24"
                     /cell_type="cultured fibroblasts"
                     /tissue_type="skin"
     CDS             <1..378
                     /function="complex catalyzes the reversible
                     decarboxylation of glycine, yielding carbon dioxide,
                     ammonia, 5-10-methylene tetrahydrofolate and reduced NADH"
                     /note="H-protein; hydrogen carrier protein precursor; part
                     of mitochondrial matrix glycine cleavage enzyme complex of
                     4 proteins: H-, L-, P-, and T-proteins"
                     /codon_start=1
                     /product="mitochondrial glycine cleavage system H-protein
                     precursor"
                     /protein_id="AAS59848.1"
                     /translation="SVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGT
                     KLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLS
                     NPSELDELMSEEAYEKYIKSIEE"
     mat_peptide     1..375
                     /product="mitochondrial glycine cleavage system H-protein"
BASE COUNT          133 a           53 c           93 g           99 t
ORIGIN      
        1 tcggtgcgta aattcacaga gaaacacgaa tgggtaacaa cagaaaatgg cattggaaca
       61 gtgggaatca gcaattttgc acaggaagcg ttgggagatg ttgtttattg tagtctccct
      121 gaagttggga caaaattgaa caaacaagat gagtttggtg ctttggaaag tgtgaaagct
      181 gctagtgaac tctattctcc tttatcagga gaagtaactg aaattaatga agctcttgca
      241 gaaaatccag gacttgtaaa caaatcttgt tatgaagatg gttggctgat caagatgaca
      301 ctgagtaacc cttcagaact agatgaactt atgagtgaag aagcatatga gaaatacata
      361 aaatctattg aggagtga
//