LOCUS AY533031 378 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens mitochondrial glycine cleavage system H-protein precursor mRNA, partial cds; nuclear gene for mitochondrial product. ACCESSION AY533031 VERSION AY533031.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 378) AUTHORS Choy,F.Y.M. and Sinclair,G. TITLE Nucleotide sequence of the mature hydrogen carrier protein in glycine cleavage enzyme complex from human cultured skin fibroblasts JOURNAL Unpublished REFERENCE 2 (bases 1 to 378) AUTHORS Choy,F.Y.M. and Sinclair,G. TITLE Direct Submission JOURNAL Submitted (26-JAN-2004) Biology, University of Victoria, P.O. Box 3020, Station CSC, Victoria, BC V8W 3N5, Canada FEATURES Location/Qualifiers source 1..378 /db_xref="H-InvDB:HIT000255201" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="16" /map="16q24" /cell_type="cultured fibroblasts" /tissue_type="skin" CDS <1..378 /function="complex catalyzes the reversible decarboxylation of glycine, yielding carbon dioxide, ammonia, 5-10-methylene tetrahydrofolate and reduced NADH" /note="H-protein; hydrogen carrier protein precursor; part of mitochondrial matrix glycine cleavage enzyme complex of 4 proteins: H-, L-, P-, and T-proteins" /codon_start=1 /product="mitochondrial glycine cleavage system H-protein precursor" /protein_id="AAS59848.1" /translation="SVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGT KLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLS NPSELDELMSEEAYEKYIKSIEE" mat_peptide 1..375 /product="mitochondrial glycine cleavage system H-protein" BASE COUNT 133 a 53 c 93 g 99 t ORIGIN 1 tcggtgcgta aattcacaga gaaacacgaa tgggtaacaa cagaaaatgg cattggaaca 61 gtgggaatca gcaattttgc acaggaagcg ttgggagatg ttgtttattg tagtctccct 121 gaagttggga caaaattgaa caaacaagat gagtttggtg ctttggaaag tgtgaaagct 181 gctagtgaac tctattctcc tttatcagga gaagtaactg aaattaatga agctcttgca 241 gaaaatccag gacttgtaaa caaatcttgt tatgaagatg gttggctgat caagatgaca 301 ctgagtaacc cttcagaact agatgaactt atgagtgaag aagcatatga gaaatacata 361 aaatctattg aggagtga //