LOCUS AY459290 186 bp mRNA linear HUM 30-NOV-2003 DEFINITION Homo sapiens HCV-E2 binding protein 1 mRNA, complete cds. ACCESSION AY459290 VERSION AY459290.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 186) AUTHORS Zhang,J., Cheng,J., Wang,L., Shao,Q., Lu,Y., Chen,T. and Hong,Y. TITLE Screening and cloning of the genes of protein interacting with the envelope 2 of hepatitis C virus JOURNAL Unpublished REFERENCE 2 (bases 1 to 186) AUTHORS Cheng,J., Zhang,J. and Wang,L. TITLE Direct Submission JOURNAL Submitted (05-NOV-2003) Gene Therapy Research Center, Institute of Infectious Diseases, 100 Xsihuan Zhonglu, Beijing 100039, China FEATURES Location/Qualifiers source 1..186 /db_xref="H-InvDB:HIT000254797" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 1..186 /codon_start=1 /product="HCV-E2 binding protein 1" /protein_id="AAR23235.1" /translation="MPRPRGCGCCCACPCDGSLVSQPVSFLPRAELPFLQESGRRCRL SWLLWGSRGTAITPPGQ" BASE COUNT 26 a 60 c 62 g 38 t ORIGIN 1 atgccccgtc cgcggggctg tggctgctgc tgtgcatgtc cctgcgatgg gagtcttgtc 61 tcccagcctg tcagtttcct ccccagggca gagctcccct tcctgcaaga gtctgggagg 121 cggtgcaggc tgtcctggct gctctgggga agccgaggga cagccataac acccccggga 181 cagtag //