LOCUS       AY423240                 339 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens clone 010.7H3L immunoglobulin light chain variable
            region mRNA, partial cds.
ACCESSION   AY423240
VERSION     AY423240.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 339)
  AUTHORS   Zhou,J., Lottenbach,K.R., Barenkamp,S.J. and Reason,D.C.
  TITLE     Somatic hypermutation and diverse immunoglobulin gene usage in the
            human antibody response to the capsular polysaccharide of
            Streptococcus pneumoniae Type 6B
  JOURNAL   Infect. Immun. 72 (6), 3505-3514 (2004)
   PUBMED   15155658
REFERENCE   2  (bases 1 to 339)
  AUTHORS   Reason,D.C. and Zhou,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-SEP-2003) Children's Hospital Oakland Research
            Institute, 5700 MLK Jr. Way, Oakland, CA 94609, USA
FEATURES             Location/Qualifiers
     source          1..339
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="010.7H3L"
     CDS             <1..>339
                     /codon_start=1
                     /product="immunoglobulin light chain variable region"
                     /protein_id="AAQ99245.1"
                     /translation="ELTQSPDSLAVSLGERATINCKSSQTVLYSSNIKNFLAWYQQKP
                     GQPPKLLIYWASTRESGVPDRFSGSGSGTNFTLTISSLQPEDVAVYYCQQYYDTPPVT
                     FGQGTKVEIKR"
BASE COUNT           84 a           97 c           82 g           76 t
ORIGIN      
        1 gagctcaccc agtctccaga ctccctggct gtgtctctgg gcgagagggc caccatcaac
       61 tgcaagtcca gccagactgt tttatatagc tccaacatta agaacttctt agcttggtac
      121 cagcagaaac caggacagcc tcctaagttg ctcatttact gggcatctac ccgggaatcc
      181 ggggtccctg accgattcag tggcagcggg tctgggacaa atttcactct caccatcagc
      241 agcctgcagc ctgaagatgt ggcagtttat tactgtcagc aatattatga cactcccccg
      301 gtgacgttcg gccaagggac caaggtggaa atcaaacga
//