LOCUS AY423240 339 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens clone 010.7H3L immunoglobulin light chain variable region mRNA, partial cds. ACCESSION AY423240 VERSION AY423240.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 339) AUTHORS Zhou,J., Lottenbach,K.R., Barenkamp,S.J. and Reason,D.C. TITLE Somatic hypermutation and diverse immunoglobulin gene usage in the human antibody response to the capsular polysaccharide of Streptococcus pneumoniae Type 6B JOURNAL Infect. Immun. 72 (6), 3505-3514 (2004) PUBMED 15155658 REFERENCE 2 (bases 1 to 339) AUTHORS Reason,D.C. and Zhou,J. TITLE Direct Submission JOURNAL Submitted (26-SEP-2003) Children's Hospital Oakland Research Institute, 5700 MLK Jr. Way, Oakland, CA 94609, USA FEATURES Location/Qualifiers source 1..339 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="010.7H3L" CDS <1..>339 /codon_start=1 /product="immunoglobulin light chain variable region" /protein_id="AAQ99245.1" /translation="ELTQSPDSLAVSLGERATINCKSSQTVLYSSNIKNFLAWYQQKP GQPPKLLIYWASTRESGVPDRFSGSGSGTNFTLTISSLQPEDVAVYYCQQYYDTPPVT FGQGTKVEIKR" BASE COUNT 84 a 97 c 82 g 76 t ORIGIN 1 gagctcaccc agtctccaga ctccctggct gtgtctctgg gcgagagggc caccatcaac 61 tgcaagtcca gccagactgt tttatatagc tccaacatta agaacttctt agcttggtac 121 cagcagaaac caggacagcc tcctaagttg ctcatttact gggcatctac ccgggaatcc 181 ggggtccctg accgattcag tggcagcggg tctgggacaa atttcactct caccatcagc 241 agcctgcagc ctgaagatgt ggcagtttat tactgtcagc aatattatga cactcccccg 301 gtgacgttcg gccaagggac caaggtggaa atcaaacga //