LOCUS AY367766 694 bp mRNA linear HUM 14-JUN-2012 DEFINITION Homo sapiens protein containing single MORN motif in testis (MOPT) mRNA, complete cds. ACCESSION AY367766 VERSION AY367766.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 694) AUTHORS Choi,Y.J., Hwang,K.C., Park,J.Y., Park,K.K., Kim,J.H., Park,S.B., Hwang,S., Park,H., Park,C. and Kim,J.H. TITLE Identification and characterization of a novel mouse and human MOPT gene containing MORN-motif protein in testis JOURNAL Theriogenology 73 (3), 273-281 (2010) PUBMED 19913896 REFERENCE 2 (bases 1 to 694) AUTHORS Hwang,K.-C., Kwon,D.-N., Choi,Y.-J., Lee,S.-Y. and Kim,J.-H. TITLE Direct Submission JOURNAL Submitted (14-AUG-2003) Division of Applied Life Science, Gyeongsang National University, Chinju, GyeongNam 660-701, Republic of Korea FEATURES Location/Qualifiers source 1..694 /db_xref="H-InvDB:HIT000253281" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="2" gene 1..694 /gene="MOPT" CDS 308..547 /gene="MOPT" /codon_start=1 /product="protein containing single MORN motif in testis" /protein_id="AAQ73170.1" /translation="MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNE NRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKLHM" misc_feature 350..412 /gene="MOPT" /note="Region: MORN motif" BASE COUNT 223 a 130 c 160 g 181 t ORIGIN 1 attcgcttcc gggtgagagg tgcccggtcg ccccagcaac caagtcgcac ctggagctgt 61 cctagcgcct agttctctcc cggccgcaga gctggccgcc cagggggagt cgcagagttt 121 ggaagatctc tctaacacct ctcggccaac ttcagaagtg tataagatca gctttatctt 181 tccaaatgga gacaagtatg atggtgactg tacaagaaca tcttctggaa tctacgagag 241 aaatggaata ggtattcata ccactcctaa tgggattgtc tacacaggaa gctggaaaga 301 tgacaagatg aatggttttg gaagacttga gcatttttca ggagcagtat atgaaggaca 361 atttaaggat aatatgtttc atggactggg gacttacaca ttcccaaatg gggcaaagta 421 tactggaaat ttcaatgaaa atagggtgga aggtgaaggg gaatatactg atatccaagg 481 actagaatgg agtggtaact ttcattttac agctgctcca gacctgaaat taaagcttca 541 catgtagatg tgatgttaaa ttaaagttga aatgtagtaa ttgaagcttt tagttgtaag 601 gaaagcaact taatctgtta tttgaaatga cttcatacac tacccctata agtttgccaa 661 taaaaccatc acctgcttac aaaaaaaaaa aaaa //