LOCUS       AY367766                 694 bp    mRNA    linear   HUM 14-JUN-2012
DEFINITION  Homo sapiens protein containing single MORN motif in testis (MOPT)
            mRNA, complete cds.
ACCESSION   AY367766
VERSION     AY367766.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 694)
  AUTHORS   Choi,Y.J., Hwang,K.C., Park,J.Y., Park,K.K., Kim,J.H., Park,S.B.,
            Hwang,S., Park,H., Park,C. and Kim,J.H.
  TITLE     Identification and characterization of a novel mouse and human MOPT
            gene containing MORN-motif protein in testis
  JOURNAL   Theriogenology 73 (3), 273-281 (2010)
   PUBMED   19913896
REFERENCE   2  (bases 1 to 694)
  AUTHORS   Hwang,K.-C., Kwon,D.-N., Choi,Y.-J., Lee,S.-Y. and Kim,J.-H.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-AUG-2003) Division of Applied Life Science,
            Gyeongsang National University, Chinju, GyeongNam 660-701, Republic
            of Korea
FEATURES             Location/Qualifiers
     source          1..694
                     /db_xref="H-InvDB:HIT000253281"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
     gene            1..694
                     /gene="MOPT"
     CDS             308..547
                     /gene="MOPT"
                     /codon_start=1
                     /product="protein containing single MORN motif in testis"
                     /protein_id="AAQ73170.1"
                     /translation="MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNE
                     NRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKLHM"
     misc_feature    350..412
                     /gene="MOPT"
                     /note="Region: MORN motif"
BASE COUNT          223 a          130 c          160 g          181 t
ORIGIN      
        1 attcgcttcc gggtgagagg tgcccggtcg ccccagcaac caagtcgcac ctggagctgt
       61 cctagcgcct agttctctcc cggccgcaga gctggccgcc cagggggagt cgcagagttt
      121 ggaagatctc tctaacacct ctcggccaac ttcagaagtg tataagatca gctttatctt
      181 tccaaatgga gacaagtatg atggtgactg tacaagaaca tcttctggaa tctacgagag
      241 aaatggaata ggtattcata ccactcctaa tgggattgtc tacacaggaa gctggaaaga
      301 tgacaagatg aatggttttg gaagacttga gcatttttca ggagcagtat atgaaggaca
      361 atttaaggat aatatgtttc atggactggg gacttacaca ttcccaaatg gggcaaagta
      421 tactggaaat ttcaatgaaa atagggtgga aggtgaaggg gaatatactg atatccaagg
      481 actagaatgg agtggtaact ttcattttac agctgctcca gacctgaaat taaagcttca
      541 catgtagatg tgatgttaaa ttaaagttga aatgtagtaa ttgaagcttt tagttgtaag
      601 gaaagcaact taatctgtta tttgaaatga cttcatacac tacccctata agtttgccaa
      661 taaaaccatc acctgcttac aaaaaaaaaa aaaa
//