LOCUS       AY345923                 373 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens isolate case 330 immunoglobulin heavy chain variable
            region mRNA, partial cds.
ACCESSION   AY345923
VERSION     AY345923.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 373)
  AUTHORS   Forconi,F., Raspadori,D., Babbage,G., Sahota,S.S., Stevenson,F.K.
            and Lauria,F.
  TITLE     Hairy cell leukemia expressing multiple Ig isotypes shows
            heterogeneity in VH gene mutational status and constitutive
            activation of AID but absence of germinal center markers
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 373)
  AUTHORS   Forconi,F., Raspadori,D., Babbage,G., Sahota,S.S., Stevenson,F.K.
            and Lauria,F.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-2003) Divisione di Ematologia, Universit di
            Siena, Viale Bracci, Siena 53100, Italy
FEATURES             Location/Qualifiers
     source          1..373
                     /db_xref="H-InvDB:HIT000252055"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="case 330"
                     /isolation_source="hairy cell leukemia patient"
                     /db_xref="taxon:9606"
     CDS             <1..>373
                     /codon_start=1
                     /product="immunoglobulin heavy chain variable region"
                     /protein_id="AAR06600.1"
                     /translation="QITLKESGPTLVKPTQTLTLTCTFSGFSLSSSGVGVGWIRQPPG
                     KALEWLALIYWDDDKRYSPSLESRLTITKDTSKNQVVLTMTDMDPVDTATYYCARRPG
                     EQLLRSSWFDPWGQGTLVTVSS"
BASE COUNT           83 a          117 c          100 g           73 t
ORIGIN      
        1 cagatcacct tgaaggagtc tggtcctacg ctggtgaaac ccacacagac cctcacgctg
       61 acctgcacct tctctgggtt ctcactcagc tctagtggag tgggtgtggg ctggatccgt
      121 cagcccccag gaaaggccct ggagtggctt gcactcattt attgggatga tgataagcgc
      181 tacagcccat ctctggagag caggctcacc atcaccaagg acacctccaa aaaccaggtg
      241 gtccttacaa tgaccgacat ggaccctgtg gacacagcca catattactg tgcacgcaga
      301 ccgggggaac agctcctccg gagcagctgg ttcgacccct ggggccaggg aaccctggtc
      361 accgtctcct cag
//