LOCUS AY345923 373 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens isolate case 330 immunoglobulin heavy chain variable region mRNA, partial cds. ACCESSION AY345923 VERSION AY345923.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 373) AUTHORS Forconi,F., Raspadori,D., Babbage,G., Sahota,S.S., Stevenson,F.K. and Lauria,F. TITLE Hairy cell leukemia expressing multiple Ig isotypes shows heterogeneity in VH gene mutational status and constitutive activation of AID but absence of germinal center markers JOURNAL Unpublished REFERENCE 2 (bases 1 to 373) AUTHORS Forconi,F., Raspadori,D., Babbage,G., Sahota,S.S., Stevenson,F.K. and Lauria,F. TITLE Direct Submission JOURNAL Submitted (18-JUL-2003) Divisione di Ematologia, Universit di Siena, Viale Bracci, Siena 53100, Italy FEATURES Location/Qualifiers source 1..373 /db_xref="H-InvDB:HIT000252055" /organism="Homo sapiens" /mol_type="mRNA" /isolate="case 330" /isolation_source="hairy cell leukemia patient" /db_xref="taxon:9606" CDS <1..>373 /codon_start=1 /product="immunoglobulin heavy chain variable region" /protein_id="AAR06600.1" /translation="QITLKESGPTLVKPTQTLTLTCTFSGFSLSSSGVGVGWIRQPPG KALEWLALIYWDDDKRYSPSLESRLTITKDTSKNQVVLTMTDMDPVDTATYYCARRPG EQLLRSSWFDPWGQGTLVTVSS" BASE COUNT 83 a 117 c 100 g 73 t ORIGIN 1 cagatcacct tgaaggagtc tggtcctacg ctggtgaaac ccacacagac cctcacgctg 61 acctgcacct tctctgggtt ctcactcagc tctagtggag tgggtgtggg ctggatccgt 121 cagcccccag gaaaggccct ggagtggctt gcactcattt attgggatga tgataagcgc 181 tacagcccat ctctggagag caggctcacc atcaccaagg acacctccaa aaaccaggtg 241 gtccttacaa tgaccgacat ggaccctgtg gacacagcca catattactg tgcacgcaga 301 ccgggggaac agctcctccg gagcagctgg ttcgacccct ggggccaggg aaccctggtc 361 accgtctcct cag //