LOCUS AY323910 1125 bp mRNA linear HUM 16-JUL-2003 DEFINITION Homo sapiens sulfatase modifying factor 1 mRNA, complete cds. ACCESSION AY323910 VERSION AY323910.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1125) AUTHORS Cosma,M.P., Pepe,S., Annunziata,I., Newbold,R.F., Grompe,M., Parenti,G. and Ballabio,A. TITLE The multiple sulfatase deficiency gene encodes an essential and limiting factor for the activity of sulfatases JOURNAL Cell 113 (4), 445-456 (2003) PUBMED 12757706 REFERENCE 2 (bases 1 to 1125) AUTHORS Cosma,M.P., Pepe,S., Annunziata,I., Newbold,R.F., Grompe,M., Parenti,G. and Ballabio,A. TITLE Direct Submission JOURNAL Submitted (15-JUN-2003) Telethon Institute of Genetics and Medicine, Via Pietro Castellino 111, Naples 80131, Italy FEATURES Location/Qualifiers source 1..1125 /db_xref="H-InvDB:HIT000251749" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="3" /map="3p26" CDS 1..1125 /function="generates a formylglycine residue from cysteine in sulfatases" /note="SUMF1; localized in the endoplasmic reticulum; similar to the Homo sapiens product of AK075459" /codon_start=1 /product="sulfatase modifying factor 1" /protein_id="AAP86217.1" /translation="MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAG SLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMG TDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEG MLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYC TWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQ GTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSY MCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD" BASE COUNT 242 a 293 c 337 g 253 t ORIGIN 1 atggctgcgc ccgcactagg gctggtgtgt ggacgttgcc ctgagctggg tctcgtcctc 61 ttgctgctgc tgctctcgct gctgtgtgga gcggcaggga gccaggaggc cgggaccggt 121 gcgggcgcgg ggtcccttgc gggttcttgc ggctgcggca cgccccagcg gcctggcgcc 181 catggcagtt cggcagccgc tcaccgatac tcgcgggagg ctaacgctcc gggccccgta 241 cccggagagc ggcaactcgc gcactcaaag atggtcccca tccctgctgg agtatttaca 301 atgggcacag atgatcctca gataaagcag gatggggaag cacctgcgag gagagttact 361 attgatgcct tttacatgga tgcctatgaa gtcagtaata ctgaatttga gaagtttgtg 421 aactcaactg gctatttgac agaggctgag aagtttggcg actcctttgt ctttgaaggc 481 atgttgagtg agcaagtgaa gaccaatatt caacaggcag ttgcagctgc tccctggtgg 541 ttacctgtga aaggcgctaa ctggagacac ccagaagggc ctgactctac tattctgcac 601 aggccggatc atccagttct ccatgtgtcc tggaatgatg cggttgccta ctgcacttgg 661 gcagggaagc ggctgcccac ggaagctgag tgggaataca gctgtcgagg aggcctgcat 721 aatagacttt tcccctgggg caacaaactg cagcccaaag gccagcatta tgccaacatt 781 tggcagggcg agtttccggt gaccaacact ggtgaggatg gcttccaagg aactgcgcct 841 gttgatgcct tccctcccaa tggttatggc ttatacaaca tagtggggaa cgcatgggaa 901 tggacttcag actggtggac tgttcatcat tctgttgaag aaacgcttaa cccaaaaggt 961 cccccttctg ggaaagaccg agtgaagaaa ggtggatcct acatgtgcca taggtcttat 1021 tgttacaggt atcgctgtgc tgctcggagc cagaacacac ctgatagctc tgcttcgaat 1081 ctgggattcc gctgtgcagc cgaccgcctg cccaccatgg actga //