LOCUS AY265863 204 bp mRNA linear HUM 26-JUL-2005 DEFINITION Homo sapiens BFK isoform c mRNA, complete cds. ACCESSION AY265863 VERSION AY265863.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 204) AUTHORS Dempsey,C.E., Dive,C., Fletcher,D.J., Barnes,F.A., Lobo,A., Bingle,C.D., Whyte,M.K. and Renshaw,S.A. TITLE Expression of pro-apoptotic Bfk isoforms reduces during malignant transformation in the human gastrointestinal tract JOURNAL FEBS Lett. 579 (17), 3646-3650 (2005) PUBMED 15961081 REFERENCE 2 (bases 1 to 204) AUTHORS Dempsey,C.E., Whyte,M.K. and Renshaw,S.A. TITLE Direct Submission JOURNAL Submitted (01-APR-2003) Division of Genomic Medicine, University of Sheffield, Glossop Road, Sheffield S10 2JF, UK FEATURES Location/Qualifiers source 1..204 /db_xref="H-InvDB:HIT000331746" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1p13.2" CDS 1..204 /note="apoptotic regulator; member of Bcl-2 family" /codon_start=1 /product="BFK isoform c" /protein_id="AAP93857.1" /translation="MKSSQTFEEQTECIVNTLLMDFLSPTLQVASRNLCCVDEVDSDR SYTPEHCGISQQDLVCSGFQLSL" BASE COUNT 59 a 47 c 48 g 50 t ORIGIN 1 atgaagagct cccaaacttt tgaggaacaa acggaatgca ttgtgaacac tctactcatg 61 gacttcttga gcccaacatt gcaggttgcc agccggaacc tatgctgtgt agatgaagta 121 gattcagaca ggagctatac tccagaacac tgtggaatct ctcagcaaga cctggtgtgc 181 tcaggattcc agcttagctt atga //