LOCUS       AY265863                 204 bp    mRNA    linear   HUM 26-JUL-2005
DEFINITION  Homo sapiens BFK isoform c mRNA, complete cds.
ACCESSION   AY265863
VERSION     AY265863.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 204)
  AUTHORS   Dempsey,C.E., Dive,C., Fletcher,D.J., Barnes,F.A., Lobo,A.,
            Bingle,C.D., Whyte,M.K. and Renshaw,S.A.
  TITLE     Expression of pro-apoptotic Bfk isoforms reduces during malignant
            transformation in the human gastrointestinal tract
  JOURNAL   FEBS Lett. 579 (17), 3646-3650 (2005)
   PUBMED   15961081
REFERENCE   2  (bases 1 to 204)
  AUTHORS   Dempsey,C.E., Whyte,M.K. and Renshaw,S.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-APR-2003) Division of Genomic Medicine, University of
            Sheffield, Glossop Road, Sheffield S10 2JF, UK
FEATURES             Location/Qualifiers
     source          1..204
                     /db_xref="H-InvDB:HIT000331746"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1p13.2"
     CDS             1..204
                     /note="apoptotic regulator; member of Bcl-2 family"
                     /codon_start=1
                     /product="BFK isoform c"
                     /protein_id="AAP93857.1"
                     /translation="MKSSQTFEEQTECIVNTLLMDFLSPTLQVASRNLCCVDEVDSDR
                     SYTPEHCGISQQDLVCSGFQLSL"
BASE COUNT           59 a           47 c           48 g           50 t
ORIGIN      
        1 atgaagagct cccaaacttt tgaggaacaa acggaatgca ttgtgaacac tctactcatg
       61 gacttcttga gcccaacatt gcaggttgcc agccggaacc tatgctgtgt agatgaagta
      121 gattcagaca ggagctatac tccagaacac tgtggaatct ctcagcaaga cctggtgtgc
      181 tcaggattcc agcttagctt atga
//