LOCUS       AY255583                 162 bp    mRNA    linear   HUM 25-JUL-2016
DEFINITION  Homo sapiens G protein-coupled receptor MRGG mRNA, partial cds.
ACCESSION   AY255583
VERSION     AY255583.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 162)
  AUTHORS   Vassilatis,D.K., Hohmann,J.G., Zeng,H., Li,F., Ranchalis,J.E.,
            Mortrud,M.T., Brown,A., Rodriguez,S.S., Weller,J.R., Wright,A.C.,
            Bergmann,J.E. and Gaitanaris,G.A.
  TITLE     The G protein-coupled receptor repertoires of human and mouse
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 100 (8), 4903-4908 (2003)
   PUBMED   12679517
REFERENCE   2  (bases 1 to 162)
  AUTHORS   Vassilatis,D.K., Hohmann,J.G., Zeng,H., Li,F., Ranchalis,J.E.,
            Mortrud,M.T., Brown,A., Rodriguez,S.S., Weller,J.R., Wright,A.C.,
            Bergmann,J.E. and Gaitanaris,G.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-MAR-2003) Primal, Inc., 1124 Columbia Street,
            Seattle, WA 98104, USA
FEATURES             Location/Qualifiers
     source          1..162
                     /db_xref="H-InvDB:HIT000085524"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             <1..>162
                     /codon_start=1
                     /product="G protein-coupled receptor MRGG"
                     /protein_id="AAO85095.1"
                     /translation="MFGLFGLWRTFDSVVFYLTLIVGLGGPVGNGLVLWNLGFRIKKG
                     PFSIYLLHLA"
BASE COUNT           23 a           49 c           50 g           40 t
ORIGIN      
        1 atgtttgggc tgttcggcct ctggagaacc ttcgacagtg tggtcttcta cctgacgctg
       61 atcgtgggcc tcgggggacc ggtaggtaac gggctggtgc tctggaacct cggcttccgc
      121 atcaagaagg gccccttctc catctacctg ctgcacctgg cc
//