LOCUS AY255583 162 bp mRNA linear HUM 25-JUL-2016 DEFINITION Homo sapiens G protein-coupled receptor MRGG mRNA, partial cds. ACCESSION AY255583 VERSION AY255583.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 162) AUTHORS Vassilatis,D.K., Hohmann,J.G., Zeng,H., Li,F., Ranchalis,J.E., Mortrud,M.T., Brown,A., Rodriguez,S.S., Weller,J.R., Wright,A.C., Bergmann,J.E. and Gaitanaris,G.A. TITLE The G protein-coupled receptor repertoires of human and mouse JOURNAL Proc. Natl. Acad. Sci. U.S.A. 100 (8), 4903-4908 (2003) PUBMED 12679517 REFERENCE 2 (bases 1 to 162) AUTHORS Vassilatis,D.K., Hohmann,J.G., Zeng,H., Li,F., Ranchalis,J.E., Mortrud,M.T., Brown,A., Rodriguez,S.S., Weller,J.R., Wright,A.C., Bergmann,J.E. and Gaitanaris,G.A. TITLE Direct Submission JOURNAL Submitted (14-MAR-2003) Primal, Inc., 1124 Columbia Street, Seattle, WA 98104, USA FEATURES Location/Qualifiers source 1..162 /db_xref="H-InvDB:HIT000085524" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS <1..>162 /codon_start=1 /product="G protein-coupled receptor MRGG" /protein_id="AAO85095.1" /translation="MFGLFGLWRTFDSVVFYLTLIVGLGGPVGNGLVLWNLGFRIKKG PFSIYLLHLA" BASE COUNT 23 a 49 c 50 g 40 t ORIGIN 1 atgtttgggc tgttcggcct ctggagaacc ttcgacagtg tggtcttcta cctgacgctg 61 atcgtgggcc tcgggggacc ggtaggtaac gggctggtgc tctggaacct cggcttccgc 121 atcaagaagg gccccttctc catctacctg ctgcacctgg cc //