LOCUS AY223855 320 bp mRNA linear HUM 25-JUL-2016 DEFINITION Homo sapiens clone 6 a disintegrin and metalloprotease 33 mRNA, partial cds. ACCESSION AY223855 VERSION AY223855.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 320) AUTHORS Powell,R.M., Wicks,J., Holloway,J.W., Holgate,S.T. and Davies,D.D. TITLE Identification of novel ADAM33 transcripts that lack the metalloprotease domain JOURNAL Unpublished REFERENCE 2 (bases 1 to 320) AUTHORS Powell,R.M., Wicks,J., Holloway,J.W., Holgate,S.T. and Davies,D.D. TITLE Direct Submission JOURNAL Submitted (22-JAN-2003) RCMB, Southampton University, Tremona Road, Southampton, Hants SO16 6YD, UK FEATURES Location/Qualifiers source 1..320 /db_xref="H-InvDB:HIT000251095" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="20" /map="between HGNC and GFRA4" /clone="6" /cell_type="primary airway fibroblast" CDS <1..>320 /note="ADAM33" /codon_start=1 /product="a disintegrin and metalloprotease 33" /protein_id="AAP15444.1" /translation="RRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQ PWRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQLLAPGYIETHYGPGQECRDLCC FAHN" BASE COUNT 57 a 103 c 105 g 55 t ORIGIN 1 cggagagctc gggggacccc gttgctgctg ctgctactac tgctgctgct ctggccagtg 61 ccaggcgccg gggtgcttca aggacatatc cctgggcagc cagtcacccc gcactgggtc 121 ctggatggac aaccctggcg caccgtcagc ctggaggagc cggtctcgaa gccagacatg 181 gggctggtgg ccctggaggc tgaaggccag gagctcctgc ttgagctgga gaagaaccag 241 ctgctggccc caggatacat agaaacccac tacggccctg gccaggagtg ccgcgacctc 301 tgctgctttg ctcacaactg //