LOCUS       AY223855                 320 bp    mRNA    linear   HUM 25-JUL-2016
DEFINITION  Homo sapiens clone 6 a disintegrin and metalloprotease 33 mRNA,
            partial cds.
ACCESSION   AY223855
VERSION     AY223855.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 320)
  AUTHORS   Powell,R.M., Wicks,J., Holloway,J.W., Holgate,S.T. and Davies,D.D.
  TITLE     Identification of novel ADAM33 transcripts that lack the
            metalloprotease domain
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 320)
  AUTHORS   Powell,R.M., Wicks,J., Holloway,J.W., Holgate,S.T. and Davies,D.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JAN-2003) RCMB, Southampton University, Tremona Road,
            Southampton, Hants SO16 6YD, UK
FEATURES             Location/Qualifiers
     source          1..320
                     /db_xref="H-InvDB:HIT000251095"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="between HGNC and GFRA4"
                     /clone="6"
                     /cell_type="primary airway fibroblast"
     CDS             <1..>320
                     /note="ADAM33"
                     /codon_start=1
                     /product="a disintegrin and metalloprotease 33"
                     /protein_id="AAP15444.1"
                     /translation="RRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQ
                     PWRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQLLAPGYIETHYGPGQECRDLCC
                     FAHN"
BASE COUNT           57 a          103 c          105 g           55 t
ORIGIN      
        1 cggagagctc gggggacccc gttgctgctg ctgctactac tgctgctgct ctggccagtg
       61 ccaggcgccg gggtgcttca aggacatatc cctgggcagc cagtcacccc gcactgggtc
      121 ctggatggac aaccctggcg caccgtcagc ctggaggagc cggtctcgaa gccagacatg
      181 gggctggtgg ccctggaggc tgaaggccag gagctcctgc ttgagctgga gaagaaccag
      241 ctgctggccc caggatacat agaaacccac tacggccctg gccaggagtg ccgcgacctc
      301 tgctgctttg ctcacaactg
//