LOCUS       AY223850                 449 bp    mRNA    linear   HUM 25-JUL-2016
DEFINITION  Homo sapiens clone 1 a disintegrin and metalloprotease 33 mRNA,
            partial cds.
ACCESSION   AY223850
VERSION     AY223850.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 449)
  AUTHORS   Powell,R.M., Wicks,J., Holloway,J.W., Holgate,S.T. and Davies,D.D.
  TITLE     Identification of novel ADAM33 transcripts that lack the
            metalloprotease domain
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 449)
  AUTHORS   Powell,R.M., Wicks,J., Holloway,J.W., Holgate,S.T. and Davies,D.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JAN-2003) RCMB, Southampton University, Tremona Road,
            Southampton, Hants SO16 6YD, UK
FEATURES             Location/Qualifiers
     source          1..449
                     /db_xref="H-InvDB:HIT000251090"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="between HGNC and GFRA4"
                     /clone="1"
                     /cell_type="primary airway fibroblast"
     CDS             <1..>449
                     /note="ADAM33"
                     /codon_start=1
                     /product="a disintegrin and metalloprotease 33"
                     /protein_id="AAP15439.1"
                     /translation="WRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVL
                     DGQPWRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQDALCGKLQCQGGKPSLLAP
                     HMVPVDSTVHLDGQEVTCRGALALPNAQLDLLGLGLVEPGTQCGPRMV"
BASE COUNT           79 a          136 c          155 g           79 t
ORIGIN      
        1 tggaggcccc ggagagctcg ggggaccccg ttgctgctgc tgctactact gctgctgctc
       61 tggccagtgc caggcgccgg ggtgcttcaa ggacatatcc ctgggcagcc agtcaccccg
      121 cactgggtcc tggatggaca accctggcgc accgtcagcc tggaggagcc ggtctcgaag
      181 ccagacatgg ggctggtggc cctggaggct gaaggccagg agctcctgct tgagctggag
      241 aagaaccagg atgccctgtg tgggaagctg cagtgccagg gtggaaagcc cagcctgctc
      301 gcaccgcaca tggtgccagt ggactctacc gttcacctag atggccagga agtgacttgt
      361 cggggagcct tggcactccc caatgcccag ctggacctgc ttggcctggg cctggtagag
      421 ccaggcaccc agtgtggacc tagaatggt
//