LOCUS AY223850 449 bp mRNA linear HUM 25-JUL-2016 DEFINITION Homo sapiens clone 1 a disintegrin and metalloprotease 33 mRNA, partial cds. ACCESSION AY223850 VERSION AY223850.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 449) AUTHORS Powell,R.M., Wicks,J., Holloway,J.W., Holgate,S.T. and Davies,D.D. TITLE Identification of novel ADAM33 transcripts that lack the metalloprotease domain JOURNAL Unpublished REFERENCE 2 (bases 1 to 449) AUTHORS Powell,R.M., Wicks,J., Holloway,J.W., Holgate,S.T. and Davies,D.D. TITLE Direct Submission JOURNAL Submitted (17-JAN-2003) RCMB, Southampton University, Tremona Road, Southampton, Hants SO16 6YD, UK FEATURES Location/Qualifiers source 1..449 /db_xref="H-InvDB:HIT000251090" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="20" /map="between HGNC and GFRA4" /clone="1" /cell_type="primary airway fibroblast" CDS <1..>449 /note="ADAM33" /codon_start=1 /product="a disintegrin and metalloprotease 33" /protein_id="AAP15439.1" /translation="WRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVL DGQPWRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQDALCGKLQCQGGKPSLLAP HMVPVDSTVHLDGQEVTCRGALALPNAQLDLLGLGLVEPGTQCGPRMV" BASE COUNT 79 a 136 c 155 g 79 t ORIGIN 1 tggaggcccc ggagagctcg ggggaccccg ttgctgctgc tgctactact gctgctgctc 61 tggccagtgc caggcgccgg ggtgcttcaa ggacatatcc ctgggcagcc agtcaccccg 121 cactgggtcc tggatggaca accctggcgc accgtcagcc tggaggagcc ggtctcgaag 181 ccagacatgg ggctggtggc cctggaggct gaaggccagg agctcctgct tgagctggag 241 aagaaccagg atgccctgtg tgggaagctg cagtgccagg gtggaaagcc cagcctgctc 301 gcaccgcaca tggtgccagt ggactctacc gttcacctag atggccagga agtgacttgt 361 cggggagcct tggcactccc caatgcccag ctggacctgc ttggcctggg cctggtagag 421 ccaggcaccc agtgtggacc tagaatggt //