LOCUS AY048588 260 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens tuberoinfundibular 39 residue protein precursor (TIP39) mRNA, partial cds. ACCESSION AY048588 VERSION AY048588.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 260) AUTHORS John,M.R., Arai,M., Rubin,D.A., Jonsson,K.B. and Juppner,H. TITLE Identification and characterization of the murine and human gene encoding the tuberoinfundibular peptide of 39 residues JOURNAL Endocrinology 143 (3), 1047-1057 (2002) PUBMED 11861531 REFERENCE 2 (bases 1 to 260) AUTHORS John,M.R., Arai,M., Rubin,D.A., Jonsson,K.B. and Jueppner,H. TITLE Direct Submission JOURNAL Submitted (27-JUL-2001) Endocrine Unit, Massachusetts General Hospital and Harvard Medical School, 50 Blossom St., WEL 501, Boston, MA 02114, USA FEATURES Location/Qualifiers source 1..260 /db_xref="H-InvDB:HIT000083821" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /tissue_type="brain, hypothalamus" gene 1..>260 /gene="TIP39" CDS 4..>260 /gene="TIP39" /note="peptide hormone; ligand of the PTH2 receptor and the PTH/PTH-related peptide receptor" /codon_start=1 /product="tuberoinfundibular 39 residue protein precursor" /protein_id="AAL06597.1" /translation="METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSL RPPGRAWADPATPRPRRSLALADDAAFRERARLLAALERRH" BASE COUNT 21 a 101 c 99 g 39 t ORIGIN 1 gtgatggaga cccgccaggt gtccaggagc cctcgggttc ggctgctgct gctgctgctg 61 ctgctgctgg tggtgccctg gggcgtccgc actgcctcgg gagtcgccct gcccccggtc 121 ggggtcctca gcctccgccc cccaggacgg gcctgggcgg atcccgccac ccccaggccg 181 cggaggagcc tggcgctggc ggacgacgcg gccttccggg agcgcgcgcg gttgctggcc 241 gccctcgagc gccgccactg //