LOCUS       AY048588                 260 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens tuberoinfundibular 39 residue protein precursor
            (TIP39) mRNA, partial cds.
ACCESSION   AY048588
VERSION     AY048588.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 260)
  AUTHORS   John,M.R., Arai,M., Rubin,D.A., Jonsson,K.B. and Juppner,H.
  TITLE     Identification and characterization of the murine and human gene
            encoding the tuberoinfundibular peptide of 39 residues
  JOURNAL   Endocrinology 143 (3), 1047-1057 (2002)
   PUBMED   11861531
REFERENCE   2  (bases 1 to 260)
  AUTHORS   John,M.R., Arai,M., Rubin,D.A., Jonsson,K.B. and Jueppner,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JUL-2001) Endocrine Unit, Massachusetts General
            Hospital and Harvard Medical School, 50 Blossom St., WEL 501,
            Boston, MA 02114, USA
FEATURES             Location/Qualifiers
     source          1..260
                     /db_xref="H-InvDB:HIT000083821"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="brain, hypothalamus"
     gene            1..>260
                     /gene="TIP39"
     CDS             4..>260
                     /gene="TIP39"
                     /note="peptide hormone; ligand of the PTH2 receptor and
                     the PTH/PTH-related peptide receptor"
                     /codon_start=1
                     /product="tuberoinfundibular 39 residue protein precursor"
                     /protein_id="AAL06597.1"
                     /translation="METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSL
                     RPPGRAWADPATPRPRRSLALADDAAFRERARLLAALERRH"
BASE COUNT           21 a          101 c           99 g           39 t
ORIGIN      
        1 gtgatggaga cccgccaggt gtccaggagc cctcgggttc ggctgctgct gctgctgctg
       61 ctgctgctgg tggtgccctg gggcgtccgc actgcctcgg gagtcgccct gcccccggtc
      121 ggggtcctca gcctccgccc cccaggacgg gcctgggcgg atcccgccac ccccaggccg
      181 cggaggagcc tggcgctggc ggacgacgcg gccttccggg agcgcgcgcg gttgctggcc
      241 gccctcgagc gccgccactg
//