LOCUS       AL834381                3217 bp    mRNA    linear   HTC 15-OCT-2008
DEFINITION  Homo sapiens mRNA; cDNA DKFZp762I0516 (from clone DKFZp762I0516).
ACCESSION   AL834381
VERSION     AL834381.1
KEYWORDS    HTC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3217)
  AUTHORS   Ansorge W., Krieger S., Regiert T., Rittmueller C., Schwager B.,
            Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M.,
            Wiemann S.
  CONSRTM   The German cDNA Consortium
  JOURNAL   Submitted (20-JAN-2005) to the INSDC. MIPS, Ingolstaedter
            Landstr.1, D-85764 Neuherberg, GERMANY
COMMENT     Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
            Research
            Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
            sequenced by EMBL (European Molecular Biology Laboratories,
            Heidelberg/Germany) within the cDNA sequencing consortium of the
            German
            Genome Project.
            This clone (DKFZp762I0516) is available at the RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
            Please contact RZPD for ordering:
            http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp762I0516
            Further information about the clone and the sequencing project is
            available at http://mips.gsf.de/projects/cdna/
FEATURES             Location/Qualifiers
     source          1..3217
                     /db_xref="H-InvDB:HIT000029111"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /clone_lib="762 (synonym: hmel2). Vector pSport1; host
                     DH10B; sites NotI + SalI"
                     /clone="DKFZp762I0516"
                     /tissue_type="melanoma (MeWo cell line)"
                     /note="hypothetical protein"
                     /db_xref="taxon:9606"
     CDS             301..>3201
                     /codon_start=1
                     /gene="DKFZp762I0516"
                     /product="hypothetical protein"
                     /db_xref="GOA:Q9UIF8"
                     /db_xref="H-InvDB:HIT000029111.18"
                     /db_xref="HGNC:HGNC:963"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001739"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR016177"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR018501"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR028941"
                     /db_xref="InterPro:IPR036427"
                     /db_xref="InterPro:IPR037374"
                     /db_xref="PDB:2E7O"
                     /db_xref="PDB:3G0L"
                     /db_xref="PDB:3Q2F"
                     /db_xref="PDB:4CUP"
                     /db_xref="PDB:4CUQ"
                     /db_xref="PDB:4CUR"
                     /db_xref="PDB:4CUS"
                     /db_xref="PDB:4CUT"
                     /db_xref="PDB:4CUU"
                     /db_xref="PDB:4IR3"
                     /db_xref="PDB:4IR4"
                     /db_xref="PDB:4IR5"
                     /db_xref="PDB:4IR6"
                     /db_xref="PDB:4NR9"
                     /db_xref="PDB:4NRA"
                     /db_xref="PDB:4NRB"
                     /db_xref="PDB:4NRC"
                     /db_xref="PDB:4QC1"
                     /db_xref="PDB:4QC3"
                     /db_xref="PDB:4QF3"
                     /db_xref="PDB:4RVR"
                     /db_xref="PDB:4XUA"
                     /db_xref="PDB:4XUB"
                     /db_xref="PDB:5CQ3"
                     /db_xref="PDB:5CQ4"
                     /db_xref="PDB:5CQ5"
                     /db_xref="PDB:5CQ6"
                     /db_xref="PDB:5CQ7"
                     /db_xref="PDB:5CQ8"
                     /db_xref="PDB:5CQA"
                     /db_xref="PDB:5CU8"
                     /db_xref="PDB:5CUA"
                     /db_xref="PDB:5CUB"
                     /db_xref="PDB:5CUC"
                     /db_xref="PDB:5CUD"
                     /db_xref="PDB:5CUE"
                     /db_xref="PDB:5CUG"
                     /db_xref="PDB:5DYU"
                     /db_xref="PDB:5DYX"
                     /db_xref="PDB:5E73"
                     /db_xref="PDB:5E74"
                     /db_xref="PDB:5E9I"
                     /db_xref="PDB:5E9K"
                     /db_xref="PDB:5E9L"
                     /db_xref="PDB:5E9M"
                     /db_xref="PDB:5E9Y"
                     /db_xref="PDB:5L8T"
                     /db_xref="PDB:5L8U"
                     /db_xref="PDB:5L96"
                     /db_xref="PDB:5L97"
                     /db_xref="PDB:5L98"
                     /db_xref="PDB:5L99"
                     /db_xref="PDB:5MGE"
                     /db_xref="PDB:5MGF"
                     /db_xref="PDB:5MGG"
                     /db_xref="PDB:5OR9"
                     /db_xref="PDB:5ORB"
                     /db_xref="PDB:5PB7"
                     /db_xref="PDB:5PB8"
                     /db_xref="PDB:5PB9"
                     /db_xref="PDB:5PBA"
                     /db_xref="PDB:5PBB"
                     /db_xref="PDB:5PBC"
                     /db_xref="PDB:5PBD"
                     /db_xref="PDB:5PBE"
                     /db_xref="PDB:5PBF"
                     /db_xref="PDB:5PBG"
                     /db_xref="PDB:5PBH"
                     /db_xref="PDB:5PBI"
                     /db_xref="PDB:5PBJ"
                     /db_xref="PDB:5PBK"
                     /db_xref="PDB:5PBL"
                     /db_xref="PDB:5PBM"
                     /db_xref="PDB:5PBN"
                     /db_xref="PDB:5PBO"
                     /db_xref="PDB:5PBP"
                     /db_xref="PDB:5PBQ"
                     /db_xref="PDB:5PBR"
                     /db_xref="PDB:5PBS"
                     /db_xref="PDB:5PBT"
                     /db_xref="PDB:5PBU"
                     /db_xref="PDB:5PBV"
                     /db_xref="PDB:5PBW"
                     /db_xref="PDB:5PBX"
                     /db_xref="PDB:5PBY"
                     /db_xref="PDB:5PBZ"
                     /db_xref="PDB:5PC0"
                     /db_xref="PDB:5PC1"
                     /db_xref="PDB:5PC2"
                     /db_xref="PDB:5PC3"
                     /db_xref="PDB:5PC4"
                     /db_xref="PDB:5PC5"
                     /db_xref="PDB:5PC6"
                     /db_xref="PDB:5PC7"
                     /db_xref="PDB:5PC8"
                     /db_xref="PDB:5PC9"
                     /db_xref="PDB:5PCA"
                     /db_xref="PDB:5PCB"
                     /db_xref="PDB:5PCC"
                     /db_xref="PDB:5PCD"
                     /db_xref="PDB:5PCE"
                     /db_xref="PDB:5PCF"
                     /db_xref="PDB:5PCG"
                     /db_xref="PDB:5PCH"
                     /db_xref="PDB:5PCI"
                     /db_xref="PDB:5PCJ"
                     /db_xref="PDB:5PCK"
                     /db_xref="PDB:5PCL"
                     /db_xref="PDB:5PCM"
                     /db_xref="PDB:5PCN"
                     /db_xref="PDB:5PCO"
                     /db_xref="PDB:5PCP"
                     /db_xref="PDB:5PCQ"
                     /db_xref="PDB:5PCR"
                     /db_xref="PDB:5PCS"
                     /db_xref="PDB:5PCT"
                     /db_xref="PDB:5PCU"
                     /db_xref="PDB:5PCV"
                     /db_xref="PDB:5PCW"
                     /db_xref="PDB:5PCX"
                     /db_xref="PDB:5PCZ"
                     /db_xref="PDB:5PD0"
                     /db_xref="PDB:5PD1"
                     /db_xref="PDB:5PD2"
                     /db_xref="PDB:5PD3"
                     /db_xref="PDB:5PD4"
                     /db_xref="PDB:5PD5"
                     /db_xref="PDB:5PD6"
                     /db_xref="PDB:5PD7"
                     /db_xref="PDB:5PD8"
                     /db_xref="PDB:5PD9"
                     /db_xref="PDB:5PDA"
                     /db_xref="PDB:5PDB"
                     /db_xref="PDB:5PDC"
                     /db_xref="PDB:5PDD"
                     /db_xref="PDB:5PDE"
                     /db_xref="PDB:5PDF"
                     /db_xref="PDB:5PDG"
                     /db_xref="PDB:5PDH"
                     /db_xref="PDB:5PDI"
                     /db_xref="PDB:5PDJ"
                     /db_xref="PDB:5PDK"
                     /db_xref="PDB:5PDL"
                     /db_xref="PDB:5PDM"
                     /db_xref="PDB:5PDN"
                     /db_xref="PDB:5PDO"
                     /db_xref="PDB:5PDP"
                     /db_xref="PDB:5PDQ"
                     /db_xref="PDB:5PDR"
                     /db_xref="PDB:5PDS"
                     /db_xref="PDB:5PDT"
                     /db_xref="PDB:5PDU"
                     /db_xref="PDB:5PDV"
                     /db_xref="PDB:5PDW"
                     /db_xref="PDB:5PDX"
                     /db_xref="PDB:5PDY"
                     /db_xref="PDB:5PDZ"
                     /db_xref="PDB:5PE0"
                     /db_xref="PDB:5PE1"
                     /db_xref="PDB:5PE2"
                     /db_xref="PDB:5PE3"
                     /db_xref="PDB:5PE4"
                     /db_xref="PDB:5PE5"
                     /db_xref="PDB:5PE6"
                     /db_xref="PDB:5PE7"
                     /db_xref="PDB:5PE8"
                     /db_xref="PDB:5PE9"
                     /db_xref="PDB:5PEA"
                     /db_xref="PDB:5PEB"
                     /db_xref="PDB:5PEC"
                     /db_xref="PDB:5PED"
                     /db_xref="PDB:5PEE"
                     /db_xref="PDB:5PEF"
                     /db_xref="PDB:5PEG"
                     /db_xref="PDB:5PEH"
                     /db_xref="PDB:5PEI"
                     /db_xref="PDB:5PEJ"
                     /db_xref="PDB:5PEK"
                     /db_xref="PDB:5PEL"
                     /db_xref="PDB:5PEM"
                     /db_xref="PDB:5PEN"
                     /db_xref="PDB:5PEO"
                     /db_xref="PDB:5PEQ"
                     /db_xref="PDB:5PER"
                     /db_xref="PDB:5PES"
                     /db_xref="PDB:5PET"
                     /db_xref="PDB:5PEU"
                     /db_xref="PDB:5PEV"
                     /db_xref="PDB:5PEW"
                     /db_xref="PDB:5PEX"
                     /db_xref="PDB:5PEY"
                     /db_xref="PDB:5PEZ"
                     /db_xref="PDB:5PF0"
                     /db_xref="PDB:5PF1"
                     /db_xref="PDB:5PF2"
                     /db_xref="PDB:5PF3"
                     /db_xref="PDB:5PF4"
                     /db_xref="PDB:5PF5"
                     /db_xref="PDB:5PF6"
                     /db_xref="PDB:5PF7"
                     /db_xref="PDB:5PF8"
                     /db_xref="PDB:5PF9"
                     /db_xref="PDB:5PFA"
                     /db_xref="PDB:5PFB"
                     /db_xref="PDB:5PFC"
                     /db_xref="PDB:5PFD"
                     /db_xref="PDB:5PFE"
                     /db_xref="PDB:5PFF"
                     /db_xref="PDB:5PFG"
                     /db_xref="PDB:5PFH"
                     /db_xref="PDB:5PFI"
                     /db_xref="PDB:5PFJ"
                     /db_xref="PDB:5PFL"
                     /db_xref="PDB:5PFM"
                     /db_xref="PDB:5PFN"
                     /db_xref="PDB:5PFO"
                     /db_xref="PDB:5PFP"
                     /db_xref="PDB:5PFQ"
                     /db_xref="PDB:5PFR"
                     /db_xref="PDB:5PFS"
                     /db_xref="PDB:5PFT"
                     /db_xref="PDB:5PFU"
                     /db_xref="PDB:5PFV"
                     /db_xref="PDB:5PFW"
                     /db_xref="PDB:5PFX"
                     /db_xref="PDB:5PFY"
                     /db_xref="PDB:5PFZ"
                     /db_xref="PDB:5PG0"
                     /db_xref="PDB:5PG1"
                     /db_xref="PDB:5PG2"
                     /db_xref="PDB:5PG3"
                     /db_xref="PDB:5PG4"
                     /db_xref="PDB:5PG5"
                     /db_xref="PDB:5PG6"
                     /db_xref="PDB:5PG7"
                     /db_xref="PDB:5PG8"
                     /db_xref="PDB:5PG9"
                     /db_xref="PDB:5PGA"
                     /db_xref="PDB:5PGB"
                     /db_xref="PDB:5PGC"
                     /db_xref="PDB:5PGD"
                     /db_xref="PDB:5PGE"
                     /db_xref="PDB:5PGF"
                     /db_xref="PDB:5PGG"
                     /db_xref="PDB:5PGH"
                     /db_xref="PDB:5PGI"
                     /db_xref="PDB:5PGJ"
                     /db_xref="PDB:5PGK"
                     /db_xref="PDB:5PGL"
                     /db_xref="PDB:5PGN"
                     /db_xref="PDB:5PGO"
                     /db_xref="PDB:5PGP"
                     /db_xref="PDB:5PGQ"
                     /db_xref="PDB:5PGR"
                     /db_xref="PDB:5PGS"
                     /db_xref="PDB:5PGT"
                     /db_xref="PDB:6FGT"
                     /db_xref="PDB:6FGU"
                     /db_xref="PDB:6FH6"
                     /db_xref="PDB:6FH7"
                     /db_xref="PDB:6FHQ"
                     /db_xref="PDB:6FI1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UIF8"
                     /protein_id="CAD39044.2"
                     /translation="MESGERLPSSAASSTTPTSSSTPSVASVVSKGGLSTGVASLSST
                     INPCGHLFRTAGDQPFNLSTVSSAFPTVSHPVFGLHSASSGHSEFGGLGTLGTPTALA
                     AHPQLASFPGAEWWRTTDAHTRTGATFFPPLLGIPPLFAPPAQNHDSSSFHSRTSGKS
                     NRNGPEKGVNGSINGSNTSSVIGINTSVLSTTASSSMGQTKSTSSGGGNRKCNQEQSK
                     NQPLDARVDKIKDKKPRKKAMESSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEED
                     QSIEESEDDDSDSESEAQHKSNNQVLLHGISDPKADGQKATEKAQEKRIHQPLPLASE
                     SQTHSFQSQQKQPQVLSQQLPFIFQSSQAKEESVNKHTSVIQSTGLVSNVKPLSLVNQ
                     AKKETYMKLIVPSPDVLKAGNKNTSEESSSLTSELRSKREQYKQAFPSQLKKQESSKS
                     LKKVIAALSNPKATSSSPAHPKQTLENNHPNPFLTNALLGNHQPNGVIQSVIQEAPLA
                     LTTKTKMQSKINENIAAASSTPFSSPVNLSTSGRRTPGNQTPVMPSASPILHSQGKEK
                     AVSNNVNPVKTQHHSHPAKSLVEQFRGTDSDIPSSKDSEDSNEDEEEDDEEEDEEDDE
                     DDESDDSQSESDSNSESDTEGSEEEDDDDKDQDESDSDTEGEKTSMKLNKTTSSVKSP
                     SMSLTGHSTPRNLHIAKAPGSAPAALCSESQSPAFLGTSSSTLTSSPHSGTSKRRRVT
                     DERELRIPLEYGWQRETRIRNFGGRLQGEVAYYAPCGKKLRQYPEVIKYLSRNGIMDI
                     SRDNFSFSAKIRVGDFYEARDGPQGMQWCLLKEEDVIPRIRAMEGRRGRPPNPDRQRA
                     REESRMRRRKGRPPNVGNAEFLDNADAKLLRKLQAQEIARQAAQIKLLRKLQKQEQAR
                     VAKEAKKQQAIMAAEEKRKQKEQIKIMKQQEKIKRIQQIRMEKELRAQQILEA"
BASE COUNT         1152 a          691 c          666 g          708 t
ORIGIN      
        1 gaagaatcat ctcctgcttc aatctgctgc tggataggaa ctaatcagag agagagaggc
       61 ggaagacgga gaaggaggga gtcgaaggct ttcccgatca caaatctcac ctccactaca
      121 actctcttta tacttttctt gcagaaataa taatagaaat aaggaggtgg tggggtttcc
      181 aaaaatctta accttcaacc atctggggaa aaggcaaaaa tcccatctac cgcaactctc
      241 agttcgagag taaaggtttc ccaacagtga tgtcacaaga ttgaccacat tgatcacaat
      301 atggagtctg gagaacggtt accatcctca gcagcctcct ctactacacc aacttcatct
      361 tcgacacctt ctgtggcttc agtagtttca aaaggtggcc tttccactgg agttgcttca
      421 cttagctcta caatcaaccc atgtggacat ttattcagaa cagctgggga tcaaccgttt
      481 aacctgtcca cagtgtcgag tgccttccca acggtcagcc acccagtctt tggtctacat
      541 tcagccagct cagggcattc agaatttggt ggtttgggga cacttggtac acccacagcc
      601 ttagccgcac atccccaact agcatctttt ccaggtgcag aatggtggcg aacaactgat
      661 gctcatactc gtacaggagc aaccttcttt ccaccattac tgggaattcc accactattt
      721 gctcccccag cccagaatca tgattcttct tcattccatt caaggacttc gggaaaaagt
      781 aatcgaaatg gtcccgaaaa aggtgtaaat gggtcaataa atggaagtaa tacatcatct
      841 gtaattggta tcaacacatc tgtactatcc actactgctt caagttccat gggacaaact
      901 aaaagtacaa gctcaggtgg aggaaatcga aaatgtaatc aggaacaaag caaaaaccag
      961 cctttggatg ctagagttga caaaatcaaa gataagaaac caaggaagaa agcaatggaa
     1021 agttctagca acagtgatag tgattcaggc acatcatcag acacctcaag tgaaggcatt
     1081 agtagcagtg attcagatga tctagaagaa gatgaagaag aagaagatca aagtattgaa
     1141 gaaagtgaag atgatgattc tgattcagag agtgaagcac aacataaaag taacaaccag
     1201 gtgctattac atggtatttc agacccaaaa gcagatggac agaaagcaac tgaaaaagcc
     1261 caggaaaaaa gaatacacca gccattacct cttgcgtctg aatcccagac tcactcattc
     1321 caatcccagc agaagcagcc tcaggttttg tcacagcagc ttccatttat tttccaaagc
     1381 tctcaggcaa aggaggaatc tgtgaacaaa cacaccagtg taatacagtc tacgggattg
     1441 gtgtccaatg tgaaaccttt atctttggta aatcaagcca aaaaggaaac ttacatgaaa
     1501 ctcatagttc cttctcctga tgttcttaaa gcagggaata aaaatacctc tgaagaatct
     1561 agttcattga ccagtgaatt gagatccaaa cgggaacaat ataaacaggc attcccatca
     1621 cagttaaaga aacaagagtc atcgaagagc ctgaagaagg ttattgcagc tttgtcaaat
     1681 ccaaaagcaa cctctagttc accagcacat ccaaaacaaa cattagaaaa caaccaccca
     1741 aatccattct tgacaaatgc acttttaggt aatcaccaac caaatggagt tattcaaagt
     1801 gtcattcaag aagctcctct agcacttact accaaaacta aaatgcagag caagattaat
     1861 gaaaacattg ctgctgcaag tagcacccct ttttcctcac ctgtaaatct gagtacaagt
     1921 gggagaagaa cccctggcaa tcagacacct gtaatgccct ctgcctctcc catcctgcat
     1981 agtcaaggga aggaaaaagc agttagcaat aatgtaaacc cagtaaaaac acagcatcac
     2041 tcccatcctg caaaatcttt agtggaacaa ttcagaggaa cagattcaga cattcccagt
     2101 agtaaagatt ctgaagattc aaatgaggat gaagaggaag atgatgaaga agaagatgag
     2161 gaagatgatg aagatgatga atctgatgac agccaatcag aatcagatag taattcagaa
     2221 tcagatacag aaggatcaga agaagaagat gatgatgata aagaccaaga tgaatcagat
     2281 agtgatactg aaggagagaa aacttcaatg aaactgaata aaacaacttc ctctgtcaaa
     2341 agcccttcca tgagtctcac aggtcactca acacctcgta acctccacat agcaaaagcc
     2401 ccaggctctg ctcctgctgc cttatgttct gaatcccagt cacctgcttt tcttggtaca
     2461 tcttcttcca cacttacttc aagcccacac tctggcactt ccaaaagaag aagagtaaca
     2521 gatgaacgtg aactgcgtat tccattggaa tatggctggc agagagagac aagaataaga
     2581 aactttggag ggcgccttca aggagaagta gcatattatg ctccatgtgg aaagaaactt
     2641 aggcagtacc ctgaagtaat aaagtatctc agcagaaatg gaataatgga tatctcaagg
     2701 gacaatttca gcttcagtgc aaaaataaga gtgggtgact tctatgaagc cagagatgga
     2761 ccgcagggaa tgcagtggtg tcttttgaaa gaagaggatg tcattcctcg tatcagggca
     2821 atggaaggtc gtagaggaag accaccaaat ccagatagac aacgagcaag agaggaatcc
     2881 aggatgagac gtcggaaagg tcgacctcca aatgttggca atgctgaatt cctagataac
     2941 gcagatgcaa agttgctaag aaaactgcaa gctcaagaaa tagccaggca agcagcacaa
     3001 ataaagcttt tgagaaaact tcaaaagcag gaacaggctc gggttgctaa agaagccaaa
     3061 aaacaacaag caataatggc tgctgaggag aagcggaagc aaaaagaaca gataaagatt
     3121 atgaaacagc aggaaaaaat taagagaata cagcaaatca gaatggaaaa agaacttcga
     3181 gctcagcaaa ttctagaggc caaaaaaaaa aaaaaaa
//