LOCUS AL832953 979 bp mRNA linear HTC 15-OCT-2008
DEFINITION Homo sapiens mRNA; cDNA DKFZp666M1010 (from clone DKFZp666M1010).
ACCESSION AL832953
VERSION AL832953.1
KEYWORDS HTC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 979)
AUTHORS Ansorge W., Krieger S., Regiert T., Rittmueller C., Schwager B.,
Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M.,
Wiemann S.
CONSRTM The German cDNA Consortium
JOURNAL Submitted (22-SEP-2004) to the INSDC. MIPS, Ingolstaedter
Landstr.1, D-85764 Neuherberg, GERMANY
COMMENT Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
Research
Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
sequenced by EMBL (European Molecular Biology Laboratories,
Heidelberg/Germany) within the cDNA sequencing consortium of the
German
Genome Project.
This clone (DKFZp666M1010) is available at the RZPD Deutsches
Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
Please contact RZPD for ordering:
http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp666M1010
Further information about the clone and the sequencing project is
available at http://mips.gsf.de/projects/cdna/
FEATURES Location/Qualifiers
source 1..979
/db_xref="H-InvDB:HIT000027865"
/organism="Homo sapiens"
/mol_type="mRNA"
/dev_stage="adult"
/clone_lib="666 (synonym: hsto2). Vector pSport1; host
DH10B; sites NotI + SalI"
/clone="DKFZp666M1010"
/tissue_type="stomach"
/note="cisplatin resistance related protein CRR9p,
N-terminus truncated"
/db_xref="taxon:9606"
CDS <2..448
/codon_start=1
/gene="DKFZp666M1010"
/product="hypothetical protein"
/db_xref="GOA:Q96KA5"
/db_xref="H-InvDB:HIT000027865.15"
/db_xref="HGNC:HGNC:24308"
/db_xref="InterPro:IPR008429"
/db_xref="InterPro:IPR030434"
/db_xref="UniProtKB/Swiss-Prot:Q96KA5"
/protein_id="CAH56333.1"
/translation="RKTEEYDTQAMKYLSYLLYPLCVGGAVYSLLNIKYKSWYSWLIN
SFVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSH
RLACFRDDVVFLVYLYQRWLYPVDKRRVNEFGESYEEKATRAPHTD"
BASE COUNT 223 a 239 c 246 g 271 t
ORIGIN
1 gaggaaaacc gaggagtacg atactcaggc catgaagtac ttgtcatacc tgctgtaccc
61 tctctgtgtc gggggtgctg tctattcact cctgaatatc aaatataaga gctggtactc
121 ctggttaatc aacagcttcg tcaacggggt ctatgccttt ggtttcctct tcatgctgcc
181 ccagctcttt gtgaactaca agttgaagtc agtggcacat ctgccctgga aggccttcac
241 ctacaaggct ttcaacacct tcattgatga cgtctttgcc ttcatcatca ccatgcccac
301 gtctcaccgg ctggcctgct tccgggacga cgtggtgttt ctggtctacc tgtaccagcg
361 gtggctttat cctgtggata aacgcagagt gaacgagttt ggggagtcct acgaggagaa
421 ggccacgcgg gcgccccaca cggactgaag gccgcccggg ctgccgccag ccaagtgcaa
481 cttgaattgt caatgagtat ttttggaagc atttggagga attcctagac attgcgtttt
541 ctgtgttgcc aaaatccctt cggacatttc tcagacatct cccaagttcc catcacgtca
601 gatttggagc tggtagcgct tacgatgccc ccacgtgtga acatctgtct tggtcacaga
661 gctgggtgct gccggtcacc ttgagctgtg gtggctcccg gcacacgagt gtccggggtt
721 cggccatgtc ctcacgcggg caggggtggg agccctcaca ggcaaggggg ctgttggatt
781 tccatttcag gtggttttct aagtgctcct tatgtgaatt tcaaacacgt atggaattca
841 ttccgcatgg actctgggat caaaggctct ttcctctttt gtttgagagt tggttgtttt
901 aaagcttaat gtatgtttct attttaaaat aaatttttct ggctgtggca aaaaaaaaaa
961 aaaaaaaaaa aaaaaaaaa
//