LOCUS AL832941 1015 bp mRNA linear HTC 15-OCT-2008
DEFINITION Homo sapiens mRNA; cDNA DKFZp666I2110 (from clone DKFZp666I2110).
ACCESSION AL832941
VERSION AL832941.1
KEYWORDS HTC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1015)
AUTHORS Ansorge W., Krieger S., Regiert T., Rittmueller C., Schwager B.,
Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M.,
Wiemann S.
CONSRTM The German cDNA Consortium
JOURNAL Submitted (22-SEP-2004) to the INSDC. MIPS, Ingolstaedter
Landstr.1, D-85764 Neuherberg, GERMANY
COMMENT Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
Research
Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
sequenced by EMBL (European Molecular Biology Laboratories,
Heidelberg/Germany) within the cDNA sequencing consortium of the
German
Genome Project.
This clone (DKFZp666I2110) is available at the RZPD Deutsches
Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
Please contact RZPD for ordering:
http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp666I2110
Further information about the clone and the sequencing project is
available at http://mips.gsf.de/projects/cdna/
FEATURES Location/Qualifiers
source 1..1015
/db_xref="H-InvDB:HIT000027853"
/organism="Homo sapiens"
/mol_type="mRNA"
/dev_stage="adult"
/clone_lib="666 (synonym: hsto2). Vector pSport1; host
DH10B; sites NotI + SalI"
/clone="DKFZp666I2110"
/tissue_type="stomach"
/note="hypothetical protein, N-terminus trunacted"
/db_xref="taxon:9606"
CDS <3..701
/codon_start=1
/gene="DKFZp666I2110"
/product="hypothetical protein"
/db_xref="H-InvDB:HIT000027853.16"
/db_xref="InterPro:IPR011990"
/db_xref="InterPro:IPR013633"
/db_xref="UniProtKB/TrEMBL:Q658X2"
/protein_id="CAH56334.1"
/translation="KLNSSVFPEGSGEGDSASSQSWTSVLEAITLMHTSLLRFHMKVS
VYPLAPLREALSQALKLYPGNQVLWRSYVQIQNKSHSASKTRRFFDTITRSAKPLEPW
LFAIEAEKLRKRLVETVQRLDGREIHATIPETGLMHRIQALFENAMRSDSGSQCPLLW
RMYLNFLVSLGNKERSKGVFYKALQNCPWAKVLYLDAVEYFPDEMQEILDLMTEKELR
VRLPLEELELLLED"
BASE COUNT 293 a 217 c 270 g 235 t
ORIGIN
1 caaaactgaa cagttctgtt ttcccagaag gctctggcga gggggacagt gccagctccc
61 agagttggac cagtgttctc gaagccatca cactgatgca cacgagcctg ctgagattcc
121 acatgaaagt gagtgtttac ccgctggccc ctctgcgaga ggcactctca caggctttaa
181 agttgtatcc aggcaaccag gttctttgga ggtcctatgt acagattcag aataagtccc
241 acagtgccag caaaaccagg agattttttg acacaatcac caggtctgcc aaacccttgg
301 agccttggtt gtttgcaatt gaagctgaga aactgaggaa gagactggtg gaaactgtcc
361 agaggttaga cggtagagag atccacgcca caattcctga gaccggctta atgcatcgga
421 tccaagccct gtttgaaaat gccatgcgca gcgacagtgg cagccagtgc cccttgctgt
481 ggaggatgta tttgaacttt ctggtttcct taggaaataa agaaagaagc aaaggtgtat
541 tctacaaagc acttcagaat tgcccttggg caaaggtgtt gtacctggac gccgtggagt
601 atttccccga tgagatgcag gagatcctgg acctgatgac tgagaaggag ctccgggtgc
661 gcctgccgct ggaggagctg gagctgctgc tggaggatta gagagcagcg ggaaaacggg
721 ctgtgcctgc gaggccaagt tgcccaccct gcggagctag gaggcgcgag cagagaacgt
781 gtgtgttagg agaactcggc ttttgaaatg ttctttctcg atagtaataa tgtgagctgc
841 cagcctctca catcttgcac actttttggg tgtgtaaatg acacaaaagt tatttacata
901 ttatatatgt gaatatgtgt atatatgtac atagccagag agtcatgcca cgtggtcatt
961 aaaccgatga tgattgagaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa
//