LOCUS AL832941 1015 bp mRNA linear HTC 15-OCT-2008 DEFINITION Homo sapiens mRNA; cDNA DKFZp666I2110 (from clone DKFZp666I2110). ACCESSION AL832941 VERSION AL832941.1 KEYWORDS HTC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1015) AUTHORS Ansorge W., Krieger S., Regiert T., Rittmueller C., Schwager B., Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M., Wiemann S. CONSRTM The German cDNA Consortium JOURNAL Submitted (22-SEP-2004) to the INSDC. MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY COMMENT Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de; sequenced by EMBL (European Molecular Biology Laboratories, Heidelberg/Germany) within the cDNA sequencing consortium of the German Genome Project. This clone (DKFZp666I2110) is available at the RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany. Please contact RZPD for ordering: http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp666I2110 Further information about the clone and the sequencing project is available at http://mips.gsf.de/projects/cdna/ FEATURES Location/Qualifiers source 1..1015 /db_xref="H-InvDB:HIT000027853" /organism="Homo sapiens" /mol_type="mRNA" /dev_stage="adult" /clone_lib="666 (synonym: hsto2). Vector pSport1; host DH10B; sites NotI + SalI" /clone="DKFZp666I2110" /tissue_type="stomach" /note="hypothetical protein, N-terminus trunacted" /db_xref="taxon:9606" CDS <3..701 /codon_start=1 /gene="DKFZp666I2110" /product="hypothetical protein" /db_xref="H-InvDB:HIT000027853.16" /db_xref="InterPro:IPR011990" /db_xref="InterPro:IPR013633" /db_xref="UniProtKB/TrEMBL:Q658X2" /protein_id="CAH56334.1" /translation="KLNSSVFPEGSGEGDSASSQSWTSVLEAITLMHTSLLRFHMKVS VYPLAPLREALSQALKLYPGNQVLWRSYVQIQNKSHSASKTRRFFDTITRSAKPLEPW LFAIEAEKLRKRLVETVQRLDGREIHATIPETGLMHRIQALFENAMRSDSGSQCPLLW RMYLNFLVSLGNKERSKGVFYKALQNCPWAKVLYLDAVEYFPDEMQEILDLMTEKELR VRLPLEELELLLED" BASE COUNT 293 a 217 c 270 g 235 t ORIGIN 1 caaaactgaa cagttctgtt ttcccagaag gctctggcga gggggacagt gccagctccc 61 agagttggac cagtgttctc gaagccatca cactgatgca cacgagcctg ctgagattcc 121 acatgaaagt gagtgtttac ccgctggccc ctctgcgaga ggcactctca caggctttaa 181 agttgtatcc aggcaaccag gttctttgga ggtcctatgt acagattcag aataagtccc 241 acagtgccag caaaaccagg agattttttg acacaatcac caggtctgcc aaacccttgg 301 agccttggtt gtttgcaatt gaagctgaga aactgaggaa gagactggtg gaaactgtcc 361 agaggttaga cggtagagag atccacgcca caattcctga gaccggctta atgcatcgga 421 tccaagccct gtttgaaaat gccatgcgca gcgacagtgg cagccagtgc cccttgctgt 481 ggaggatgta tttgaacttt ctggtttcct taggaaataa agaaagaagc aaaggtgtat 541 tctacaaagc acttcagaat tgcccttggg caaaggtgtt gtacctggac gccgtggagt 601 atttccccga tgagatgcag gagatcctgg acctgatgac tgagaaggag ctccgggtgc 661 gcctgccgct ggaggagctg gagctgctgc tggaggatta gagagcagcg ggaaaacggg 721 ctgtgcctgc gaggccaagt tgcccaccct gcggagctag gaggcgcgag cagagaacgt 781 gtgtgttagg agaactcggc ttttgaaatg ttctttctcg atagtaataa tgtgagctgc 841 cagcctctca catcttgcac actttttggg tgtgtaaatg acacaaaagt tatttacata 901 ttatatatgt gaatatgtgt atatatgtac atagccagag agtcatgcca cgtggtcatt 961 aaaccgatga tgattgagaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa //