LOCUS AL713777 1341 bp mRNA linear HTC 15-OCT-2008
DEFINITION Homo sapiens mRNA; cDNA DKFZp434M202 (from clone DKFZp434M202).
ACCESSION AL713777
VERSION AL713777.1
KEYWORDS HTC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1341)
AUTHORS Ansorge W., Krieger S., Regiert T., Rittmueller C., Schwager B.,
Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M.,
Wiemann S.
CONSRTM The German cDNA Consortium
JOURNAL Submitted (22-SEP-2004) to the INSDC. MIPS, Ingolstaedter
Landstr.1, D-85764 Neuherberg, GERMANY
COMMENT Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
Research
Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
sequenced by EMBL (European Molecular Biology Laboratories,
Heidelberg/Germany) within the cDNA sequencing consortium of the
German
Genome Project.
This clone (DKFZp434M202) is available at the RZPD Deutsches
Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
Please contact RZPD for ordering:
http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp434M202
Further information about the clone and the sequencing project is
available at http://mips.gsf.de/projects/cdna/
FEATURES Location/Qualifiers
source 1..1341
/db_xref="H-InvDB:HIT000026698"
/organism="Homo sapiens"
/mol_type="mRNA"
/dev_stage="adult"
/clone_lib="434 (synonym: htes3). Vector pSport1; host
DH10B; sites NotI + SalI"
/clone="DKFZp434M202"
/tissue_type="testis"
/note="hypothetical protein, alternative start,
differentially spliced"
/db_xref="taxon:9606"
CDS 87..638
/codon_start=1
/gene="DKFZp434M202"
/product="hypothetical protein"
/db_xref="GOA:Q5VZ19"
/db_xref="H-InvDB:HIT000026698.17"
/db_xref="HGNC:HGNC:25316"
/db_xref="InterPro:IPR000504"
/db_xref="InterPro:IPR002999"
/db_xref="InterPro:IPR012677"
/db_xref="InterPro:IPR035979"
/db_xref="UniProtKB/Swiss-Prot:Q5VZ19"
/protein_id="CAD28538.1"
/translation="MIQQPRAPLVLEKASGEGFGKTAAIIQLAPKAPVDLCETEKLRA
AFFAVPLEMRGSFLVLLLRECFRDLSWLALIHSVRGEAGLLVTSIVPKTPFFWAMHIT
EALHQNMQALFSTLAQAEEQQPYLEAPPLCAGLAVWQSTTWGIMDTPGTGVGCWTGWT
PGLWSCSLILDSWPPSLCSLCAS"
BASE COUNT 310 a 349 c 348 g 334 t
ORIGIN
1 gcaatccagg agctgaatgg taactcttcc acaagcgaaa actgttcgtg aatacaagca
61 aaaggccccc caagaggacc cctgatatga tccagcagcc tcgggccccg ctggtgttgg
121 agaaggcttc tggtgaagga tttggcaaaa ccgccgctat tatacagctc gctcctaaag
181 ctcctgttga cctgtgtgag acagagaaac tgagggcagc cttctttgca gtcccgttgg
241 aaatgagagg gtccttcctg gtgctgctcc tgagggaatg cttccgagac ctgagctggc
301 tggcactcat ccatagcgtc cgtggggagg cggggctgct ggtgacgagt atcgtcccga
361 agaccccgtt tttctgggcc atgcacatca ctgaggctct gcaccagaac atgcaggctc
421 tgtttagcac cctggctcag gcggaggagc agcagcccta cctggaggct ccaccgttat
481 gcgcgggact cgctgtctgg cagagtacca cctgggggat tatggacacg cctggaacag
541 gtgttgggtg ctggacaggg tggacacctg ggctgtggtc atgttcattg attttggaca
601 gttggccacc atccctgtgc agtctctgcg ccagctagac agcgacgact tctggaccat
661 cccacccctg actcagccat tcatgctgga gaaagacatt ttgagttcgt atgaggttgt
721 ccatcgaatc ctcaaaggga aaatcactgg tgctttgaac tcggcggtaa ctgctcctgc
781 atctaacttg gctgttgtcc ctccactcct gcccttgggg tgtctgcagc aggctgctgc
841 ctaggcctgg acacattgca catcctaaag tttgaagagt ctaaataacg gggcttccct
901 cagcatgttc cctctcctgt ttgccacgga tccagagcca cctgccctgt cttctcgtac
961 ccctttcact cttgaggcct gggaggtgaa aaaggccaga ctgtgcccag gattgattca
1021 attttgcttt tactcccagc ttccctctca aaagagagtg aagtctcatt tgtcatgtgt
1081 cttcagttcc ccaacttggc atgaacattt gaaccaaaca taggaaacta ccattaggtt
1141 gaaagcctga ggcagctggg atggtctttc ttgtgtctct tctttgcacc ccagagcatg
1201 atataagtgg tcctaacaga ttctggataa tggagaagcc ctctgctggt tttcctggca
1261 ttccatgtag aataggtaga gaatatttaa ccaatgagca aataaatgtt ggcatgtttc
1321 atgaaaaaaa aaaaaaaaaa a
//