LOCUS AL590888 631 bp mRNA linear HUM 14-NOV-2006 DEFINITION Novel human mRNA from chromosome 22; splice variant of D63487 Human mRNA for KIAA0153 gene, partial cds. ACCESSION AL590888 VERSION AL590888.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 631) AUTHORS Goward M.E., Huckle E.J. JOURNAL Submitted (24-APR-2001) to the INSDC. E-mail contact: humquery@sanger.ac.uk COMMENT This cDNA sequence was assembled from public domain ESTs and single pass sequencing reads from expressed DNA templates, aligned to the genomic DNA sequence from the bacterial clone 526I14 (Z82214). The EST sequences listed match this sequence with an identity of at least 95% between the coordinates shown. Further information can be found at http://www.sanger.ac.uk/HGP/Chr22/ FEATURES Location/Qualifiers source 1..631 /db_xref="H-InvDB:HIT000250640" /organism="Homo sapiens" /chromosome="22" /mol_type="mRNA" /tissue_type="Fetal brain" /db_xref="taxon:9606" exon 1..177 /number=1 misc_feature 1..533 /note="matches EST BE279380 from clone IMAGE:3504490" misc_feature 1..381 /note="matches EST BE885387 from clone IMAGE:3909112" misc_feature join(1..66,67..84,85..533) /note="matches EST BE273624 from clone IMAGE:3506813" misc_feature join(1..78,67..533) /note="matches EST BE730974 from clone IMAGE:3845622" CDS 1..>631 /product="hypothetical protein" /db_xref="H-InvDB:HIT000250640.12" /db_xref="InterPro:IPR027749" /db_xref="UniProtKB/TrEMBL:Q9BR23" /protein_id="CAC37415.1" /translation="MEAERGPERRPAERSSPGQTPEEGAQALAEFAALHGPALRASGV PERYWGRLLHKLEHEVFDAGEVFGIMQVEEVEEEEDEAAREVRKQQPNPGNELCYKVI VTRESGLQAAHPNSIFLIDHAWTCRVEHARQQLQQVPGLLHRMANLMGIEFHGELPST EAVALVLEEMWKFNQTYHVCRRPHAEVGQRPRWKAGDAAADPGGELQPRL" exon 178..347 /number=2 misc_feature 247..533 /note="matches EST AL120762 from clone DKFZp762B132" misc_feature join(294..398,401..500) /note="matches EST AA323544" misc_feature join(315..400,401..431,433..533) /note="matches EST BE536311 from clone IMAGE:3448970" misc_feature join(320..379,402..515) /note="matches EST BF345958 from clone IMAGE:4153312" exon 348..533 /number=3 misc_feature 416..533 /note="matches EST AA075850 from clone IMAGE:531523" misc_feature complement(531..631) /note="matches EST BF835144" /note="matches EST BF761157" misc_feature 531..631 /note="matches EST BE901964 from clone IMAGE:3959455" /note="matches EST BF980938 from clone IMAGE:4395574" /note="matches EST BE255622 from clone IMAGE:3352858" /note="matches EST BF970051 from clone IMAGE:4360467" misc_feature 532..572 /note="matches EST BE869538 from clone IMAGE:3849606" exon 534..578 /number=4 misc_feature join(566..587,585..610,611..631) /note="matches EST BF686801 from clone IMAGE:4301894" misc_feature join(577..594,607..631) /note="matches EST BE885103 from clone IMAGE:3912397" exon 579..631 /number=5 misc_feature 582..630 /note="matches EST AA754774 from clone IMAGE:1181280" misc_feature 589..631 /note="matches EST W86730 from clone IMAGE:416758" misc_feature 594..631 /note="matches EST AL039205 from clone DKFZp727A231" BASE COUNT 122 a 185 c 233 g 91 t ORIGIN 1 atggaggccg agcggggtcc cgagcgccgg cctgcggagc gtagcagccc gggccagacg 61 ccggaggagg gcgcgcaggc cttggccgag ttcgcggcgc tgcacggccc ggcgctgcgc 121 gcttcggggg tccccgaacg ttactggggc cgcctcctgc acaagctgga gcacgaggtt 181 ttcgacgctg gggaagtgtt tgggatcatg caagtggagg aggtagaaga ggaggaggac 241 gaggcagccc gggaggtgcg gaagcagcag cccaacccgg ggaacgagct gtgctacaag 301 gtcatcgtga ccagggagag cgggctccag gcagcccacc ccaacagcat cttcctcatc 361 gaccacgcct ggacgtgccg tgtggagcac gcgcgccagc agctgcagca ggtgcccggg 421 ctgctgcacc gcatggccaa cctgatgggc attgagttcc acggtgagct gcccagtaca 481 gaggctgtgg ccctggtgct ggaggagatg tggaagttca accagaccta ccatgtatgc 541 cgtcgacctc atgctgaagt gggacaacgg cccagatgga aggcgggtga tgcagccgca 601 gatcctggag gtgaacttca accccgactg t //