LOCUS       AL590888                 631 bp    mRNA    linear   HUM 14-NOV-2006
DEFINITION  Novel human mRNA from chromosome 22; splice variant of D63487 Human
            mRNA for KIAA0153 gene, partial cds.
ACCESSION   AL590888
VERSION     AL590888.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 631)
  AUTHORS   Goward M.E., Huckle E.J.
  JOURNAL   Submitted (24-APR-2001) to the INSDC. E-mail contact:
            humquery@sanger.ac.uk
COMMENT     This cDNA sequence was assembled from public domain ESTs and single
            pass sequencing reads from expressed DNA templates, aligned to the
            genomic DNA sequence from the bacterial clone 526I14 (Z82214).
            The EST sequences listed match this sequence with an identity
            of at least 95% between the coordinates shown.
            Further information can be found at
            http://www.sanger.ac.uk/HGP/Chr22/
FEATURES             Location/Qualifiers
     source          1..631
                     /db_xref="H-InvDB:HIT000250640"
                     /organism="Homo sapiens"
                     /chromosome="22"
                     /mol_type="mRNA"
                     /tissue_type="Fetal brain"
                     /db_xref="taxon:9606"
     exon            1..177
                     /number=1
     misc_feature    1..533
                     /note="matches EST BE279380 from clone IMAGE:3504490"
     misc_feature    1..381
                     /note="matches EST BE885387 from clone IMAGE:3909112"
     misc_feature    join(1..66,67..84,85..533)
                     /note="matches EST BE273624 from clone IMAGE:3506813"
     misc_feature    join(1..78,67..533)
                     /note="matches EST BE730974 from clone IMAGE:3845622"
     CDS             1..>631
                     /product="hypothetical protein"
                     /db_xref="H-InvDB:HIT000250640.12"
                     /db_xref="InterPro:IPR027749"
                     /db_xref="UniProtKB/TrEMBL:Q9BR23"
                     /protein_id="CAC37415.1"
                     /translation="MEAERGPERRPAERSSPGQTPEEGAQALAEFAALHGPALRASGV
                     PERYWGRLLHKLEHEVFDAGEVFGIMQVEEVEEEEDEAAREVRKQQPNPGNELCYKVI
                     VTRESGLQAAHPNSIFLIDHAWTCRVEHARQQLQQVPGLLHRMANLMGIEFHGELPST
                     EAVALVLEEMWKFNQTYHVCRRPHAEVGQRPRWKAGDAAADPGGELQPRL"
     exon            178..347
                     /number=2
     misc_feature    247..533
                     /note="matches EST AL120762 from clone DKFZp762B132"
     misc_feature    join(294..398,401..500)
                     /note="matches EST AA323544"
     misc_feature    join(315..400,401..431,433..533)
                     /note="matches EST BE536311 from clone IMAGE:3448970"
     misc_feature    join(320..379,402..515)
                     /note="matches EST BF345958 from clone IMAGE:4153312"
     exon            348..533
                     /number=3
     misc_feature    416..533
                     /note="matches EST AA075850 from clone IMAGE:531523"
     misc_feature    complement(531..631)
                     /note="matches EST BF835144"
                     /note="matches EST BF761157"
     misc_feature    531..631
                     /note="matches EST BE901964 from clone IMAGE:3959455"
                     /note="matches EST BF980938 from clone IMAGE:4395574"
                     /note="matches EST BE255622 from clone IMAGE:3352858"
                     /note="matches EST BF970051 from clone IMAGE:4360467"
     misc_feature    532..572
                     /note="matches EST BE869538 from clone IMAGE:3849606"
     exon            534..578
                     /number=4
     misc_feature    join(566..587,585..610,611..631)
                     /note="matches EST BF686801 from clone IMAGE:4301894"
     misc_feature    join(577..594,607..631)
                     /note="matches EST BE885103 from clone IMAGE:3912397"
     exon            579..631
                     /number=5
     misc_feature    582..630
                     /note="matches EST AA754774 from clone IMAGE:1181280"
     misc_feature    589..631
                     /note="matches EST W86730 from clone IMAGE:416758"
     misc_feature    594..631
                     /note="matches EST AL039205 from clone DKFZp727A231"
BASE COUNT          122 a          185 c          233 g           91 t
ORIGIN      
        1 atggaggccg agcggggtcc cgagcgccgg cctgcggagc gtagcagccc gggccagacg
       61 ccggaggagg gcgcgcaggc cttggccgag ttcgcggcgc tgcacggccc ggcgctgcgc
      121 gcttcggggg tccccgaacg ttactggggc cgcctcctgc acaagctgga gcacgaggtt
      181 ttcgacgctg gggaagtgtt tgggatcatg caagtggagg aggtagaaga ggaggaggac
      241 gaggcagccc gggaggtgcg gaagcagcag cccaacccgg ggaacgagct gtgctacaag
      301 gtcatcgtga ccagggagag cgggctccag gcagcccacc ccaacagcat cttcctcatc
      361 gaccacgcct ggacgtgccg tgtggagcac gcgcgccagc agctgcagca ggtgcccggg
      421 ctgctgcacc gcatggccaa cctgatgggc attgagttcc acggtgagct gcccagtaca
      481 gaggctgtgg ccctggtgct ggaggagatg tggaagttca accagaccta ccatgtatgc
      541 cgtcgacctc atgctgaagt gggacaacgg cccagatgga aggcgggtga tgcagccgca
      601 gatcctggag gtgaacttca accccgactg t
//